ISSto7

  • Family IS1
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_003106 ND Sulfolobus tokodaii
Sulfolobus tokodaii 7
DNA section
IS Length : 1174 bp

Ends


IR Length : 43/50

IRL : GGGACTGTTCTCAAACAGTCATGAAATTCGATAATTGTTTGTAAAAATAT
IRR : GGGACTGTTCTCATGCAGTCATGAAATTCGAAAGTTATTTGTAATATTAT

Insertion site


Left flankDirect repeatRight flankDR Length
GAAAAGACTTCGGAACCTAAGCTTTCTA8
TAGACCAATTAGAGAATAAAATAATAGA8

DNA sequence

GGGACTGTTCTCAAACAGTCATGAAATTCGATAATTGTTTGTAAAAATATTATGATGTTCATAAAAATAGTTTTTTCTAATGTGACTCACTAAGAAGAGC
TAGAAGTATAAAGAGTAAAAATCATTTTTAGAAAAGTTTATGTGCAAGGGTCACGAGGTTATATGGGGGTTCACGAGATGAACCTCGTAACCCTTGCACA
ATTAATACTTTTGGTTCTGAGGAATTTAAATTTTAAGCCAAGAAAACACGATTTAGAAGACCTTGCTTACGCAATAGCAGCATACCTACTAGGAGTACAA
GTCACCAAACTGGGAATACCACCATCAACACTATACTACTACACTAAAAAGCTTGGAGTAAAGAGGAGAAGAGAAGAAAAACCACCTTGTCCCTCATGCA
AATCAAACAAAATAGTAAAGAACGGCTCATCTAGAGGAAAAACAAAATACAAGTGCAAAACTTGCGGGAGAACATTCTATCAAACACAAAACCACAAGAT
GAGTAAAGAACAAAAGGAAAGGATACTGAAAGAGTACACTAACAGAATGAGTATGAGAGGAGTAGCAAGGGTTGAAGGAAAACCACTAACAACAATATAC
AGTCTAGTGATGAGGAAGGGGATAGAGGCATATGCACACTTATTAATCCTACAAGAACAACTAAAGAACTTCACAGCAAAATCCACGGTAATTGATGAGA
GTTGGACTTACGTGAGGATTAGGCACGGTTCAAAAAGGGAGAACTTGTGGATATGGAACGCATTAACTGATGGTGTACCCTTCTTCACCACGGGTGATAG
GGATTATAGGACTTTCAGTTACCTCTTGAATACCCTACCTAAGAGCAAGGTATATTACACTGATGATTACTCAGTTTATCAAGTACTCAACAATCATGTT
GTAAGTAAGAAGTACACATACACCGTGGAGAGTTATAATTCTTACTGTAGGACTCATTTAGCTAGGTTGGCAAGGGATACAAGGGCTGTTAATAGGAGTA
GGAGGATGGTTGACTATAGTCTTGCCTTGTTGAACGTCATGTACCCGGTAGTTTATTCAAGGGAGAAAACTCCCTTAAATGAGGCTTACTTGAAGGGGGT
ACAGTATATTAGAAGTAAACTGATATAATATTACAAATAACTTTCGAATTTCATGACTGCATGAGAACAGTCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
987 bp328 aa1421128+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

VQGSRGYMGVHEMNLVTLAQLILLVLRNLNFKPRKHDLEDLAYAIAAYLLGVQVTKLGIPPSTLYYYTKKLGVKRRREEKPPCPSCKSNKIVKNGSSRGK
TKYKCKTCGRTFYQTQNHKMSKEQKERILKEYTNRMSMRGVARVEGKPLTTIYSLVMRKGIEAYAHLLILQEQLKNFTAKSTVIDESWTYVRIRHGSKRE
NLWIWNALTDGVPFFTTGDRDYRTFSYLLNTLPKSKVYYTDDYSVYQVLNNHVVSKKYTYTVESYNSYCRTHLARLARDTRAVNRSRRMVDYSLALLNVM
YPVVYSREKTPLNEAYLKGVQYIRSKLI

 

Blast result :
Comments
ISSto7 is 48% aa similar to ISMae3.
References
1] Kawarabayasi,Y., Hino,Y., Horikawa,H., Jin-no,K., Takahashi,M., Sekine,M., Baba,S., Ankai,A., Kosugi,H., Hosoyama,A., Fukui,S., Nagai,Y., Nishijima,K., Otsuka,R., Nakazawa,H., Takamiya,M., Kato,Y., Yoshizawa,T., Tanaka,T., Kudoh,Y., Yamazaki,J., Kushida,N., Oguchi,A., Aoki,K., Masuda,S., Yanagii,M., Nishimura,M., Yamagishi,A., Oshima,T. and Kikuchi,H. (2001) DNA Res. 8 (4), 123-140