IS1141

  • Family IS3
  • Group IS3
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
L10239 ND Mycobacterium intracellulare
Mycobacterium intracellulare
DNA section
IS Length : 1588 bp

Ends


IR Length : 18/23

IRL : TCTGCCAACCTGGGTTGAGGCACCTGCCCCCTGACAATTAGTGACCCGAG
IRR : TCTGTCAACCCTGAATGAGGCACTGTTGAGGGTATTTACTGAATGGCCTC

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

TCTGCCAACCTGGGTTGAGGCACCTGCCCCCTGACAATTAGTGACCCGAGGGCGGGGATGGAGAGCTTCCCCAAGATGGCGAACACGGTGACCACATTGG
TCCGATCGACCGGGATCGAAGATCCTGGCCGGATGAACGACGCTGGGACGGAACGTCCCGACCCTGAGGTGCCCGAGCGTGCCCGACGCCGGACGTTCAC
CGCGAAGTACAAGCTGGAGATCCTGGCCGCTTACGACGCTGCTCCCGAAGGCGAGAAGGGTGCGCTGTTGCGCCGGGAGGGGCTGTATTCCAGCCACATT
GTGGCGTGGCGGCGGGCCCGCGACGCCGGCGCGTTGGCTGGCTTGGCCGTTCCGCGCGGACGTAAGCGGCGCGACCCACAGGGCGAGCGGATCGCCCGGC
TGGAGGCCGAAAAACACCAACTGGAGCAGGAGCTGGCCAAGACCCGCTTCGTGGTGGACGTCCAGGCAAAACTGCACGCGCTCTTGGAGACGCTCTCCGA
GAGCGCGGAGCCCGAGAACGGGTCGATGAAGTGAGCGACGCAGCGATCAGCGAGCTGGCGCCCAAGATCGGCGTACGCAACGCCTGCGATGCCGTCGGTG
TCGCCCAAGCCAGCTACTACCGCCGGCACCGCAAAGCCCGCCACCGCAGCGGCCGGCGCCGATCCCGCACACCGACCGGGTGCAGCCGCGTGCATTGTCC
CGCCGCCGAGCGGGCCGCGATCCTCAATGAGTTGCACAGCGAGCGGTTCATCGACACCTCGCCGACCGAAGTGTGGGCCACACTGCTCGACGAAGGCCGC
TACCTCGGCTCGATCTCGACCTTCTACCGGCTGCTGCGCCAAGCCGGCGAAAGCCGGGAGCGCCGCCGGCAGGCCACCCACCCAGCAACGGTAAAACCCG
AGCTGGTCGCGTTCGAGCCGAACCAGGTGTGGAGTTGGGATATCACCAAGCTGCGCGGCCCGGCGAAGTGGAGCTGGTACTACCTCTACGTGATCTTGGA
CATCTTCTCCCGCTACGTGGTCGGATGGATGGTCGCTAGTCGCGAAAGTGCCGCGCTCGCTGAGGTATTGATCCGCCAGACCTGCGCCAAGCAGGACATC
GGGCGCGACCGGTTGACCATCCACGCCGACCGCGGCTCCTCGATGACCTCCAAGCCGGTGGCGTTCCTGCTCGCCGACCTCGGCGTCACCCAGTCGCACT
CACGCCCACACGTCTCCGACGACAACCCGTTCAGCGAGGCGCAATTCAAGACGTTGAAATATCGGCCCGACTTCCCCGACCGGTTCGACTCGATCGAGGC
CGCCCGCCGGCACTGCCAGATCTTCTTCGGCTGGTACAACGACGAACATCGCCATACCGGGCTGGGTTTACACGTTCCTGCCGACGTGCACTACGGCACC
GCCGCGATCATCCGCGACAAGCGCGCCGGCGTGCTCGACGCCGCCTACGCCGCACACCCAGAACGGTTCGTGCAAAAGCCGCCCGAACCACCGAAACTGC
CCAGCGGCTCATGGATCAACAAACCAGACGACACCGAGGAGGCCATTCAGTAAATACCCTCAACAGTGCCTCATTCAGGGTTGACAGA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1023 bp340 aa5311553+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

VSDAAISELAPKIGVRNACDAVGVAQASYYRRHRKARHRSGRRRSRTPTGCSRVHCPAAERAAILNELHSERFIDTSPTEVWATLLDEGRYLGSISTFYR
LLRQAGESRERRRQATHPATVKPELVAFEPNQVWSWDITKLRGPAKWSWYYLYVILDIFSRYVVGWMVASRESAALAEVLIRQTCAKQDIGRDRLTIHAD
RGSSMTSKPVAFLLADLGVTQSHSRPHVSDDNPFSEAQFKTLKYRPDFPDRFDSIEAARRHCQIFFGWYNDEHRHTGLGLHVPADVHYGTAAIIRDKRAG
VLDAAYAAHPERFVQKPPEPPKLPSGSWINKPDDTEEAIQ

 

Blast result :
Comments
Note that the ends proposed for IS1141 (Via and Falkinham, 1993) are quite different from those of the other IS3 group members. Confirmation of their validity is required. Similarly, the biological significance of the proposed single ORF (27 % identical to ORF2 of IS222) remains to be confirmed.
References
1] Via, L.E., and Falkinham, J.O.III. (1995) EMBL Data Library, Rel. 44.