LOCUS Exported 7400 bp ds-DNA linear BCT 27-APR-2021 DEFINITION Enterobacter aerogenes plasmid R751, complete sequence. ACCESSION U67194 VERSION . KEYWORDS Tn402-U67194.4 SOURCE Klebsiella aerogenes ORGANISM Klebsiella aerogenes REFERENCE 1 (bases 1 to 7400) AUTHORS Shapiro JA, Sporn P. TITLE Tn402: a new transposable element determining trimethoprim resistance that inserts in bacteriophage lambda. JOURNAL J. Bacteriol. 1977;129:1632-5. PUBMED 321437 REFERENCE 2 (bases 1 to 7400) AUTHORS Ferrante AA, Lessie TG. TITLE Nucleotide sequence of IS402 from Pseudomonas cepacia. JOURNAL Gene 1991;102:143-4. PUBMED 1650732 REFERENCE 3 (bases 1 to 7400) AUTHORS Marchiaro P, Viale AM, Ballerini V, Rossignol G, Vila AJ, Limansky A. TITLE First report of a Tn402-like class 1 integron carrying blaVIM-2 in Pseudomonas putida from Argentina. JOURNAL J Infect Dev Ctries 2010;4:412-6. PUBMED 20601796 REFERENCE 4 (bases 1 to 7400) AUTHORS Sajjad A, Holley MP, Labbate M, Stokes HW, Gillings MR. TITLE Preclinical class 1 integron with a complete Tn402-like transposition module. JOURNAL Appl. Environ. Microbiol. 2011;77:335-7. PUBMED 21037292 REFERENCE 5 (bases 1 to 7400) AUTHORS Smith CA, Thomas CM. TITLE Comparison of the nucleotide sequences of the vegetative replication origins of broad host range IncP plasmids R751 and RK2 reveals conserved features of probable functional importance. JOURNAL Nucleic Acids Res. 1985;13:557-72. PUBMED 4000925 REFERENCE 6 (bases 1 to 7400) AUTHORS Haines AS, Thomas CM.Direct SubmissionSubmitted (15-JUL-2005) School of Biological Sciences, University of Birmingham, Edgbaston, Birmingham B15 2TT, UK TITLE JOURNAL REFERENCE 7 (bases 1 to 7400) AUTHORS . TITLE Direct Submission JOURNAL Exported Tuesday, Apr 27, 2021 from SnapGene 5.2.4 https://www.snapgene.com COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Bacteriol."; date: "1977"; volume: "129"; pages: "1632-5" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Gene"; date: "1991"; volume: "102"; pages: "143-4" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "J Infect Dev Ctries"; date: "2010"; volume: "4"; pages: "412-6" COMMENT SGRef: number: 4; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2011"; volume: "77"; pages: "335-7" COMMENT SGRef: number: 5; type: "Journal Article"; journalName: "Nucleic Acids Res."; date: "1985"; volume: "13"; pages: "557-72" COMMENT SGRef: number: 6; type: "Journal Article"; journalName: "" COMMENT On Jul 15, 2005 this sequence version replaced U67194.3. FEATURES Location/Qualifiers source 1..7400 /organism="Klebsiella aerogenes" /plasmid="R751" /mol_type="genomic DNA" /note="broad host range; IncP plasmid" /db_xref="taxon:548" mobile_element 1..7400 /mobile_element_type="transposon:Tn402" /label=Tn402 /note="Accession = Tn402-U67194.4; Family = Tn402; Group =; Synonyms = Tn5090; Partial = ; Transposition = Yes; OtherInformation = ; Hosts: Organism = Klebsiella aerogenes (capsular type 37)|Taxonomy = |BacGroup = |MolecularSource = plasmid R375|Region = London|Country = United Kingdom|OtherLocInfo = peritoneal-dialysis catheter St Thomas's Hospital 1974|DateIdentified = 1977|First = yes; Capture = yes " repeat_region 1..33 /label=IRt (Tn402) /note="Name = IRt; AssociatedElement = Tn402;LibraryName = IRt (Tn402); OtherInformation = IRL;Capture = yes" repeat_region 9..27 /label=repeat t1 (Tn402) /note="Name = repeat t1; AssociatedElement = Tn402; LibraryName = repeat t1 (Tn402); OtherInformation = probable transposase binding site; Capture = yes" repeat_region complement(49..67) /label=repeat t2 (Tn402) /note="Name = repeat t2; AssociatedElement = Tn402; LibraryName = repeat t2 (Tn402); OtherInformation = probable transposase binding site; Capture = yes" repeat_region 78..97 /label=repeat t3 (Tn402) /note="Name = repeat t3; AssociatedElement = Tn402; LibraryName = repeat t3 (Tn402); OtherInformation = probable transposase binding site; Capture = yes" repeat_region 110..128 /label=repeat t4 (Tn402) /note="Name = repeat t4; AssociatedElement = Tn402; LibraryName = repeat t4 (Tn402); OtherInformation = probable transposase binding site; Capture = yes" CDS 142..1821 /codon_start=1 /gene="tniA" /product="TniA" /label=tniA (Tn402) /note="AssociatedElement = Tn402; Class = Transposase; Subclass = ; SequenceFamily = ; Chemistry = DDE; Target = ; LibraryName = tniA (Tn402); OtherInformation = can be extended upstream by 12 amino acids| identical to tniA (Tn1721 and In2)| 25% amino acid sequence identity to TnsB from Tn7; Capture = yes" /translation="MATDTPRIPEQGVATLPDEAWERARRRAEIISPLAQSETVGHEAA DMAAQALGLSRRQVYVLIRRARQGSGLVTDLVPGQSGGGKGKGRLPEPVERVIHELLQK RFLTKQKRSLAAFHREVTQVCKAQKLRVPARNTVALRIASLDPRKVIRRREGQDAARDL QGVGGEPPAVTAPLEQVQIDHTVIDLIVVDDRDRQPIGRPYLTLAIDVFTRCVLGMVVT LEAPSAVSVGLCLVHVACDKRPWLEGLNVEMDWQMSGKPLLLYLDNAAEFKSEALRRGC EQHGIRLDYRPLGQPHYGGIVERIIGTAMQMIHDELPGTTFSNPDQRGDYDSENKAALT LRELERWLTLAVGTYHGSVHNGLLQPPAARWAEAVARVGVPAVVTRATSFLVDFLPILR RTLTRTGFVIDHIHYYADALKPWIARRERWPSFLIRRDPRDISRIWVLEPEGQHYLEIP YRTLSHPAVTLWEQRQALAKLRQQGREQVDESALFRMIGQMREIVTSAQKATRKARRDA DRRQHLKTSARPDKPVPPDTDIADPQADNLPPAKPFDQIEEW" regulatory 1810..1813 /regulatory_class="ribosome_binding_site" /gene="tniB" CDS 1824..2732 /codon_start=1 /transl_table=11 /gene="tniB" /product="TniB" /label=tniB (Tn402) /note="AssociatedElement = Tn402; Class = Accessory Gene; Subclass =; Target = ; SequenceFamily = ATP binding protein?; Chemistry =; LibraryName = tniB (Tn402); OtherInformation = identical to tniB (Tn1721)| similar function to Tn7 tnsC and MuB; Capture = yes" /protein_id="AEH26328.1" /translation="MDEYPIIDLSHLLPAAQGLARLPADERIQRLRADRWIGYPRAVEA LNRLEALYAWPNKQRMPNLLLVGPTNNGKSMIVEKFRRTHPASSDADQEHIPVLVVQMP SEPSVIRFYVALLAAMGAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAGNSV NRREFLNLLRFLGNELRIPLVGVGTRDAYLAIRSDDQLENRFEPMMLPVWEANDDCCSL LASFAASLPLRRPSPIATLDMARYLLTRSEGTIGELAHLLMAAAIVAVESGEEAINHRT LSMAVYTGPSERRRQFERELM" CDS 2729..3946 /codon_start=1 /transl_table=11 /gene="tniQ" /product="TniQ" /label=tniQ (Tn402) /note="AssociatedElement= Tn402; Class = Accessory Gene; Subclass = Target Site Selection; Target = ; SequenceFamily= ; Chemistry = ; LibraryName = tniQ (Tn402); OtherInformation = identical to tniQ (Tn1721)|similar function to Tn7 tnsD?; Capture = yes " /protein_id="AEH26327.1" /translation="MKPAPRWPLHPAPKEGEALSSWLNRVALCYHMEEPDLLEHDLGHG QVDDLDTAPPLSLLALLSQRSGIELDRLRCMSFAGWVPWLLDSLDDQIPDALETYAFQL SVLLPRLRRKTRSITSWRAWLPSQPINRACPLCLSDPENQAVLLAWKLPLMLSCPLHGC WLESYWGVPGRFLGWENADAEPRTASDAIAAMDQRTWQALTTGHVELPRRRIHAGLWFR LLRTLLDELNTPLSACGTCAGYPRQVWEGCGHPLRAGQSLWRPYETLNPIVRLQMLEAA ATAISLIEVRDISPPGEQAKLFWSEPQTGFTSGLPTKAPKPEPINHWQRAVQAIDEAII EARHNPETARSLFALASYGRRDPASLERLRATFVKEGIPPEFLSHYLPDAPFACLKQND GLSDKF" misc_feature 3824..3837 /label=r6 (Tn402) /note="Name = r6; AssociatedElement = Tn402; LibraryName = r6 (Tn402); OtherInformation = ; Capture = yes." misc_feature 3870..3883 /label=r5 (Tn402) /note="Name = r5; AssociatedElement = Tn402; LibraryName = r5 (Tn402); OtherInformation = ; Capture = yes." misc_feature complement(3875..3888) /label=r4 (Tn402) /note="Name = r4; AssociatedElement = Tn402; LibraryName = r4 (Tn402); OtherInformation = ; Capture = yes." misc_feature 3926..3939 /label=r3 (Tn402) /note="Name = r3; AssociatedElement = Tn402; LibraryName = r3 (Tn402); OtherInformation = ; Capture = yes." misc_feature 3967..4001 /label=res (Tn402) /note="Name = res; AssociatedElement = Tn402; LibraryName = res (Tn402); Capture = yes " misc_feature complement(3970..3983) /label=r2 (Tn402) /note="Name = r2; AssociatedElement = Tn402; LibraryName = r2 (Tn402); OtherInformation = ; Capture = yes." misc_feature 3986..3999 /label=r1 (Tn402) /note="Name = r1; AssociatedElement = Tn402; LibraryName = r1 (Tn402); OtherInformation = ; Capture = yes." regulatory 3998..4002 /regulatory_class="ribosome_binding_site" /gene="tniC" CDS 4008..4631 /codon_start=1 /transl_table=11 /gene="tniR" /product="TniR" /label=tniR (Tn402) /note="AssociatedElement = Tn402; Class = Accessory Gene; Subclass = Resolvase; Target = ; SequenceFamily = Serine Site-Specific Recombinase; Chemistry = Serine; LibraryName = tniR (Tn402); OtherInformation = resolution of cointegrates || Protein: ACE81792.1 || identical to tniR (Tn1721); Capture = yes; Capture = yes; " /protein_id="AEH26329.1" /translation="MLIGYMRVSKADGSQSTNLQRDALIAAGVSLAHLYEDLASGRRDD RPGLAACLKALREGDTLIVWKLDRLGRDLRHLINTVHDLTARSVGLKVLTGHGAAVDTT TAAGKLVFGIFAALAEFERELISERTVAGLISARARGRKGGRPFKMTAAKLRLAMASMG QPETKVGDLCEELGITRQTLYRHVSPKGELRPDGVKLLSLGSAA" misc_feature join(4728..4868,5315..5320) /label=attC qacE (Tn402) /note="Name = attC qacE; AssociatedElement = Tn402; LibraryName = attC qacE (Tn402); OtherInformation = ; Capture =" misc_feature 4728..4868 /label=attC qacE core (Tn402) /note="Name = attC qacE core; AssociatedElement = Tn402; LibraryName = attC qacE core (Tn402); OtherInformation = integron attC IntI-type integrase recombination site; Capture = yes" CDS complement(4880..5212) /codon_start=1 /transl_table=11 /gene="qacE (ARO:3005009)" /product="QacE" /function="antibiotic efflux (ARO:0010000)" /label=qacE (Tn402) /note="AssociatedElement = Tn402; Class = Passenger Gene; Subclass = Antibiotic Resistance; SequenceFamily = major facilitator superfamily (MFS) antibiotic efflux pump (ARO:0010002); Target = quaternary ammonium salts; Chemistry = ; LibraryName = qacE (Tn402); OtherInformation = SMR export pump||strict match to reference sequence for ARO:3005009 (bitscore:204); Capture = yes" /protein_id="AEH26330.1" /translation="MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFY FLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIVSGVVVLNLL SKASAH" regulatory 5220..5223 /regulatory_class="ribosome_binding_site" /gene="qacE" misc_feature 5315..5320 /gene="attC" xxxx /product="AttC" /label=attC-qacE2 3'-end (Tn6007) /note="Name = attC-qacE2 3'-end; AssociatedElement = Tn6007; LibraryName: attC-qacE2 3'-end (Tn6007); OtherInformation = IntI1-type integrase recombination site; Capture = yes;" CDS complement(5317..5607) /codon_start=1 /gene="orfD" /product="OrfD" /function="unknown" /label=orfD (Tn402) /note="AssociatedElement= Tn402; Class = Passenger Gene; Subclass = Hypothetical;SequenceFamily = ; Target =; Chemistry = ; LibraryName = orfD (Tn402); OtherInformation = ; Capture = yes" /protein_id="AAC64462.1" /translation="MFIQTAFSFSNAVQRWVCRFSGLRLVALRWFVVFLASGPCVASAS SYFFRSAVPPRWHRAFSQLAPVAKLRLSVLASGSNISVKPTRILRSAYLAR" misc_feature join(5326..5373,5635..5641) /label=attC orfD (Tn402) /note="Name = attC orfD; AssociatedElement = Tn402; LibraryName = attC orfD (Tn402); OtherInformation = ; Capture =" misc_feature 5326..5373 /label=attC orfD core (Tn402) /note="Name = attC orfD core; AssociatedElement = Tn402; LibraryName = attC orfD core (Tn402); OtherInformation = IntI-type integrase recombination site; Capture = yes " CDS complement(5744..5980) /codon_start=1 /gene="dfrB3 (ARO:3003022) " /product="DfrB3 " /function="antibiotic target replacement (ARO:0001002)" /label=dfrB3 (Tn402) /note="AssociatedElement = Tn402; Class = Passenger Gene; Subclass = Antibiotic Resistance; SequenceFamily = trimethoprim resistant dihydrofolate reductase dfr (ARO:3001218); Target = diaminopyrimidine antibiotic (ARO:3000171); Chemistry = ; LibraryName = dfrB3 (Tn402); OtherInformation = 100% identity to reference sequence ARO:3003022 in Klebsiella oxytoca (bitscore: 163); Capture = yes " /protein_id="AAC64461.1" /translation="MDQHNNGVSTLVAGQFALPSHATFGLGDRVRKKSGAAWQGQVVGW YCTKLTPEGYAVESESHPGSVQIYPVAALERVA" regulatory 5987..5989 /regulatory_class="ribosome_binding_site" /gene="dhfrIIc" misc_feature 6049..6104 /label=attI (Tn402) /note="Name = attI; AssociatedElement = Tn402; LibraryName = attI1 (Tn6007); OtherInformation = integron-associated recombination site recognized by IntI1; Capture = yes; " protein_bind 6157..6172 /label=LexA binding site /bound_moiety="LexA binding site" gene 6185..7198 /gene="int" /label=int CDS 6185..7198 /codon_start=1 /transl_table=11 /gene="intI1" /locus_tag="Kpn2146_5747" /product="IntI1" /label=intI1 (Tn402) /note="AssociatedElement = Tn402; Class = Integron Integrase; Subclass = Class 1; SequenceFamily = Class 1 Integron Tyrosine Integrase; Chemistry = Tyrosine; Target = ; LibraryName = intI1 (Tn402); OtherInformation = ; Capture = yes" /db_xref="GI:582035613" /protein_id="AHI38944.1" /translation="MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVNWVRAFI RFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEI GRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHG TIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPR AGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPHTLRH SFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLTSER" promoter complement(6272..6300) /gene="intI1 (promoter lies within the coding sequence)" /label=Pc promoter /note="class 1 integron promoter" repeat_region complement(7281..7299) /label=repeat i4 (Tn402) /note="Name = repeat i4; AssociatedElement = Tn402; LibraryName = repeat i4 (Tn402); OtherInformation = probable transposase binding site; Capture = yes" repeat_region complement(7309..7327) /label=repeat i3 (Tn402) /note="Name = repeat i3; AssociatedElement = Tn402; LibraryName = repeat i3 (Tn402); OtherInformation = probable transposase binding site; Capture = yes" repeat_region complement(7351..7369) /label=repeat i2 (Tn402) /note="Name = repeat i2; AssociatedElement = Tn402; LibraryName = repeat i2 (Tn402); OtherInformation = probable transposase binding site; Capture = yes" repeat_region complement(7368..7400) /label=IRi (Tn402) /note="Name = IRi; AssociatedElement = Tn402;LibraryName = IRi (Tn402); OtherInformation = IRR;Capture = yes" repeat_region complement(7374..7392) /label=repeat i1 (Tn402) /note="Name = repeat i1; AssociatedElement = Tn402; LibraryName = repeat i1 (Tn402); OtherInformation = probable transposase binding site; Capture = yes" ORIGIN 1 tgtcattttc agaagacgac tgcaccagtt gattgggcgt aatggctgtt gtgcagccag 61 ctcctgacag ttcaatatca gaagtgatct gcaccaatct cgactatgct caatactcgt 121 gtgcaccaaa gcgaggtgag catggcgacg gacaccccac ggattccaga acaaggcgtg 181 gccactctgc ctgatgaggc ttgggagcgt gcgcgccgtc gtgcggagat catcagtccg 241 ttggcgcagt cggagacggt cgggcacgaa gcggccgata tggcggctca ggcgctgggc 301 ttgtctcggc gccaggtata cgttctgatc cggcgtgccc ggcaaggcag cggcctcgtg 361 acggatctgg tgcccggcca gtccggtgga ggtaaaggta aggggcgctt gccggaaccg 421 gtcgagcgcg tcatccacga gctactgcaa aagcggttcc tgaccaagca gaagcgcagc 481 ctagcggcct ttcaccgcga agtcactcag gtgtgcaagg ctcaaaaact gcgagtgccg 541 gcgcgcaata ccgtggcctt acggatcgct agccttgacc cgcgcaaggt catccgccgg 601 cgggaaggcc aggatgccgc tcgtgaccta caaggtgtgg gcggcgagcc tcctgccgtg 661 accgcgccgc tggagcaggt gcagatagac catacggtca tcgacctgat cgtggtcgat 721 gaccgcgacc ggcaacctat tggccgcccg tacctgaccc tcgccatcga cgtgttcacc 781 cgctgcgtgc tcggcatggt cgtcacgctg gaagcgccgt ctgccgtttc ggttggcctg 841 tgcctcgtgc atgtcgcctg cgacaagcgc ccttggctgg aaggactgaa cgtggaaatg 901 gattggcaga tgagcggcaa gcccttgctg ctctacctag acaacgcggc cgagttcaag 961 agcgaggccc tgcgccgggg ttgcgagcag catggcatcc ggctggacta tcgcccgctg 1021 ggacagccgc actatggcgg catcgtggaa cggatcatcg gcacggcgat gcagatgatt 1081 cacgacgaac tgccgggaac gaccttctcc aaccctgacc agcgcggcga ctacgattcc 1141 gaaaacaagg ccgccctgac gctgcgcgag ctagagcgct ggctcacatt ggcggtcggc 1201 acctaccacg gttcggtgca caacggcctg ctccaaccgc cggccgcgcg ctgggccgag 1261 gccgtggcgc gtgtcggcgt accggccgtc gtcacacgcg ctacttcgtt cctggtcgat 1321 tttctgccga tcctccggcg cacgctgacc cgcaccggct ttgtcatcga ccacatccac 1381 tactacgccg atgcgctcaa gccgtggatt gcgcggcgtg aacgctggcc gtcctttctg 1441 atccggcgcg atccgcgcga catcagccgt atctgggtcc tggaaccgga gggacagcat 1501 tacctggaaa ttccctaccg taccttgtcg catccggctg tcaccctctg ggaacaacgg 1561 caggcgctgg cgaaactgcg gcagcaaggg cgcgaacagg tggatgagtc ggcgctgttc 1621 cgcatgatcg gccagatgcg tgagattgtg accagcgcgc agaaggccac acgcaaggcg 1681 cggcgtgacg cggatcgccg ccagcacctc aagacatcag ctcggccgga caagcccgtt 1741 ccgccggata cggatattgc cgacccgcag gcagacaact tgccacccgc caaaccgttc 1801 gaccagattg aggagtggta gccgtggacg aatatcccat catcgacctg tcccacctgc 1861 tgccggcggc ccagggcttg gcccgtcttc cggcggacga gcgcatccag cgccttcgcg 1921 ccgaccgctg gatcggctat ccgcgcgcag tcgaggcgct gaaccggctg gaagcccttt 1981 atgcgtggcc aaacaagcaa cgcatgccca acctgctgct ggttggcccg accaacaatg 2041 gcaagtcgat gatcgtcgag aagttccgcc gcacccaccc ggccagctcc gacgccgacc 2101 aggagcacat cccggtgttg gtcgtgcaga tgccgtccga gccgtccgtg atccgcttct 2161 acgtcgcgct gctcgccgcg atgggcgcgc cgctgcgccc acgcccacgg ttgccggaaa 2221 tggagcaact ggctctggca ctgctgcgca aggtcggcgt gcgcatgctg gtgatcgacg 2281 agctgcacaa cgtgctggcc ggcaacagcg tcaaccgccg ggaattcctc aacctgctgc 2341 gcttcctcgg caacgaactg cgcatcccgt tggttggggt aggcacgcgc gacgcctacc 2401 tagccatccg ctccgatgac cagttggaaa atcgcttcga gccgatgatg ctgccggtat 2461 gggaggccaa cgacgattgc tgctcactgc tggccagctt cgccgcttcg ctcccgctgc 2521 gccggccttc cccaattgcc acgctggaca tggctcgcta cctgctcaca cgcagcgagg 2581 gcaccatagg ggaactggcg cacttgctga tggcggcggc catcgtcgcc gtggagagcg 2641 gcgaggaagc gatcaaccat cgcacactca gcatggccgt ttacaccgga cccagcgagc 2701 ggcggcggca attcgagcgg gaactgatgt gaagcctgcg ccgcgctggc cgctgcatcc 2761 cgccccgaaa gaaggcgagg cgctgtcctc atggctcaac cgcgtggccc tttgctatca 2821 catggaggag cccgacctgc tggagcacga tcttggtcac ggccaggtcg atgacctgga 2881 caccgcgcca ccactctcgc tgctggcgtt gctttcccag cggagcggca tcgagctgga 2941 ccggctgcgc tgtatgagtt tcgccggatg ggtgccttgg ctactggaca gccttgatga 3001 ccagattcca gacgccttgg aaacctatgc gtttcagctc tcggtgttgc tgccaagact 3061 ccgccgtaag acgcgatcca tcacgagctg gcgtgcctgg ctgcccagcc agccgataaa 3121 ccgcgcctgt ccgctctgcc tgagcgatcc ggagaaccaa gccgtactgc tcgcgtggaa 3181 gctgcccctg atgctgagct gcccgctgca tggctgctgg ctggaatcct attggggcgt 3241 gccagggcgg tttctcggtt gggagaacgc cgacgccgaa ccgcgcaccg ccagcgacgc 3301 gattgcggcg atggaccagc gtacctggca ggcactgaca accggtcacg tggagctgcc 3361 gcgccgacgc atccacgccg gattgtggtt tcgacttctt cgcacgctgc tcgatgagct 3421 gaacaccccg ctttccgcgt gcggaacctg cgcggggtat ccccgccaag tctgggaagg 3481 ctgcgggcat ccgctgcgtg ctgggcaaag tctgtggcga ccgtatgaaa ccctgaatcc 3541 gatagtacgg ttacagatgc tggaggcggc ggcaacggca atcagcttga ttgaggtgag 3601 ggacatcagc ccgccaggcg agcaggcaaa gctattctgg tccgagcccc aaaccgggtt 3661 caccagtggc ctgccgacga aagcgccgaa gcccgagccc atcaatcact ggcagcgtgc 3721 agtccaggcc atcgacgagg ccatcattga agcgcgacac aaccccgaga cggcacgctc 3781 gctgttcgcg ttggcttcct atggtcggcg cgatcccgct tccttggaac ggttgcgcgc 3841 caccttcgtg aaggaaggca tcccgccgga atttctgtca cattacctgc ctgatgcacc 3901 ctttgcatgt cttaaacaaa atgacgggtt aagtgacaaa ttttgacgga tagagctttc 3961 cggctcacac tgtcacataa tcgaacgtat acgtgacggg tgaaaaggtg ctgatcggct 4021 acatgcgggt atcgaaggcg gacggatccc agtccaccaa tttgcaacgc gatgcgctca 4081 tcgccgctgg tgtgagcctt gcgcaccttt acgaggatct ggcctcgggc aggcgcgatg 4141 atcgcccagg gttggctgct tgcctgaagg cgcttcgtga aggggacacg ctgatcgtgt 4201 ggaagctcga tcggcttggc cgtgatctgc gccacctgat caacaccgtg cacgacctaa 4261 ctgcgcgtag cgtgggcctg aaggtcctga ccggtcacgg tgcggcggtc gacacgacga 4321 ctgccgccgg caagcttgtg ttcggtattt ttgccgcgct ggccgagttc gagcgtgagt 4381 tgatttccga gcgaacagtc gctggactta tctcggcgcg cgctcgcggc aggaaagggg 4441 ggcgcccctt caagatgacc gccgccaagc tacgcctggc gatggccagc atggggcaac 4501 cggaaaccaa ggtgggcgat ctctgcgaag aactcgggat tacccggcag acgctctacc 4561 ggcacgtgtc gcccaagggc gaactgcggc cagacggcgt aaagctgctc tccctcggtt 4621 cagccgcata aatggaggcg acctggaacg gggcgctgtt cagtgcggca acgatccgat 4681 taccggtgtc gacccagagc agccgtagag cttttgggaa agctgtcgtt caacgccgag 4741 ttcagcggca gtttttaagt tgtgatttta tggaatactt ttgcgcagca aaaccataaa 4801 gccgcgactt aaaaactgtc cagcgcaggc acgaagtgct ggagcggtgc tgcaacgact 4861 tgttagatga ctgagtttat tagtgggcac ttgctttgga aagcaagttt aaaactacta 4921 caccactaac tatgagcccc atacctacaa agccccacgc atcaagcttt tgcccatgaa 4981 gcaaccaggc aatggctgta attatgacga cgccgagtcc cgaccagact gcataagcaa 5041 caccgacagg gatggatttc agaaccagag aaagaaaata aaatgcgatg ccataaccga 5101 ttatgacaac ggcggaaggg gcaagcttag taaagccctc gctagatttt aatgcggatg 5161 ttgcgattac ttcgccaact attgcgataa caagaaaaag ccagcctttc atgatatatc 5221 tcccaatttg tgtagggctt attatgcacg cttaaaaata ataaaagcag acttgacctg 5281 atagtttggc tgtgagcaat tatgtgctta gtgcatctaa cgggcgaggt aagccgaccg 5341 cagaatgcgg gtcggcttga ccgaaatgtt agagccagaa gccaaaacgg ataaccgtaa 5401 cttggcgacg ggcgctaact gcgaaaaggc acggtgccac cgaggcggca cagcactacg 5461 aaaaaaatag ctgctcgcgc ttgctacaca agggccagag gccaaaaaga ccacaaacca 5521 gcgtaacgcc accaggcgaa gcccagagaa acggcaaacc cagcgctgca cagcgtttga 5581 gaaactgaat gccgtttgaa taaacatggg cgaaataaag gagggtttca gtggtactaa 5641 cgctctagct cagcgggcgg cgaagccgtc cgctggagcg accagttggg ctgtgggcgg 5701 tactgcacgg cttgagcgct gagcggtgca ctcaaccgtg aattcaggcc acgcgttcaa 5761 gcgcagccac aggataaatc tgtactgaac cggggtgaga ctcggactcg acggcatagc 5821 cttcaggggt cagttttgtg cagtaccacc cgacaacttg accctgccaa gcggcgccag 5881 atttcttgcg cacgcgatct cccaggccaa acgtggcgtg cgatgggagc gcaaactggc 5941 cagcaactag agtactgact ccattgttgt gttggtccat atctgacctt tcttgtgaat 6001 ttcttgagat gcttgctagc ccgacaacgc tgcgtcggtg aagcccaact ttgttttagg 6061 gcgactgccc tgctgcgtaa catcgttgct gctccataac atcaaacatc gacccacggc 6121 gtaacgcgct tgctgcttgg atgcccgagg catagactgt acaaaaaaac agtcataaca 6181 agccatgaaa accgccactg cgccgttacc accgctgcgt tcggtcaagg ttctggacca 6241 gttgcgtgag cgcatacgct acttgcatta cagtttacga accgaacagg cttatgtcaa 6301 ctgggttcgt gccttcatcc gtttccacgg tgtgcgtcac ccggcaacct tgggcagcag 6361 cgaagtcgag gcatttctgt cctggctggc gaacgagcgc aaggtttcgg tctccacgca 6421 tcgtcaggca ttggcggcct tgctgttctt ctacggcaag gtgctgtgca cggatctgcc 6481 ctggcttcag gagatcggaa gacctcggcc gtcgcggcgc ttgccggtgg tgctgacccc 6541 ggatgaagtg gttcgcatcc tcggttttct ggaaggcgag catcgtttgt tcgcccagct 6601 tctgtatgga acgggcatgc ggatcagtga gggtttgcaa ctgcgggtca aggatctgga 6661 tttcgatcac ggcacgatca tcgtgcggga gggcaagggc tccaaggatc gggccttgat 6721 gttacccgag agcttggcac ccagcctgcg cgagcagctg tcgcgtgcac gggcatggtg 6781 gctgaaggac caggccgagg gccgcagcgg cgttgcgctt cccgacgccc ttgagcggaa 6841 gtatccgcgc gccgggcatt cctggccgtg gttctgggtt tttgcgcagc acacgcattc 6901 gaccgatcca cggagcggtg tcgtgcgtcg ccatcacatg tatgaccaga cctttcagcg 6961 cgccttcaaa cgtgccgtag aacaagcagg catcacgaag cccgccacac cgcacaccct 7021 ccgccactcg ttcgcgacgg ccttgctccg cagcggttac gacattcgaa ccgtgcagga 7081 tctgctcggc cattccgacg tctctacgac gatgatttac acgcatgtgc tgaaagttgg 7141 cggtgccgga gtgcgctcac cgcttgatgc gctgccgccc ctcactagtg agaggtaggg 7201 cagcgcaagt caatcctggc ggattcacta cccctgcgcg aaggccatcg gtgccgcatc 7261 gaacggccgg ttgcggaaag tcctccctgc gtccgctgat ggccggcagc agcccgtcgt 7321 tgcctgatgg atccaacccc tccgctgcta tagtgcagtc ggcttctgac gttcagtgca 7381 gccgtcttct gaaaacgaca //