ISXca5

  • Family IS5
  • Group IS5
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007508 ND Xanthomonas campestris
Xanthomonas campestris pv. vesicatoria 85-10
DNA section
IS Length : 1514 bp

Ends


IR Length : 19

IRL : GTCGCCCCTGAAAAACCCCCAGACCACATCCATTGCAAGGCTTCATCTGC
IRR : GTCGCCCCTGAAAAACCCCTCTCAAACCTCCAGTGCCATGTTTGCGGACC

Insertion site


Left flankDirect repeatRight flankDR Length
GGGACGGAGGTAATTAGCCCAACCGC6

DNA sequence

GTCGCCCCTGAAAAACCCCCAGACCACATCCATTGCAAGGCTTCATCTGCGTTATCGGTGTGCTGGAATTGCCAGTTTTCGTTACGCTACGTCCTGGTTT
CTGGCAGTTTTCGCCCATGCGTACACGCCGTCCTGCCGCCGAGCAGTTGCCTGCCGATGAGCTGTTTCGTTCGCGTCTGGAGAACCAGATCGACTTGCGC
CATCCACTGGTCCAGCTGATTCATCGGCTGCCGTGGAGTGCGTTGGAGCAGGCGCTGTCGCCGCGGTTGCCGGCTACCCCCGGCACAGGCGGTCGGCCCG
CACTGCCGGTGCGCCTGATCGCCGGCTTGCTCTACCTCAAGCACGCCTACGGCCTGTCCGATGAAGCGGTGTGCGAGCGCTGGCTGGAAAATCCTTATTG
GCAGTTCTTCACCGGTGAGGTGGTGTTCCAGACCTGCTTGCCGTGCGATCCCAGCTCCCTGACACGTTGGCGACAGCGCCTGGGCGAAGCCGGGATGGAA
GAGCTGTTGGCGCACACCATCAACACCGCTCATGTGATGAAGGCAGTGGATGCGCGCGAGTTGTCGCGGGTGATCGTGGACACCACCGTGCAGGAAAAAG
CAATCGCCCATCCCACCGACAGCGGTTTGCTGGAGGTGGCGCGCAAGAAGCTGGTGCTGCTGGCCAAGCGACACGGCATCGCACTGCGACAGAGCTATGC
GCGGCTAGGTCCGGCGTTGCGCCGCAAGGCCGGGCGCTATGCGCATGCGCGCCAGTTCAAGCGCATGCGCAAGGTGCTGCGACGCCAACGCACGGTCCTG
GGACGCGTATTACGCGATCTGCAACGCAAGCTGGCCCGGCTGGAACCGTCGGTGCATGAGGGCATCAGTGTCTGGTTGGAGCGCGCACACCGGCTGTTGA
CACAGCGTCCCAAGGACAAACAAAAGCTCTACGCGTTGCACGCGCCAGAAGTGGAATGCATGAGCAAGGGCAAGGCGCGTCAACCGTACGAGTTTGGCGT
CAAGGTCGGCATTGCGGTGAGTGCGCGCAAGGGCTTGATCGTGGGCGCGCGCAGTTTCCCGGGTAACCCGTACGACGGCGACACGCTGGCCGAGCAACTG
GAACAGGCGCGCGGGCTGCTGCAGGATGTGAATGTGATACCGCAGGTGGCGATCGTGGACCTGGGGTATCGCGGGCGCGACGTGGAAGGTGTGCAGATCC
TGCATCGTGGCAAGGCCAACACGCTGACACGGCGGCAATGGCGCTGGATCAAACGACGGCAAGCGGTAGAGCCGGTGATCGGACATCTGAAACAGGACTG
CCGCTTGAATCGCTGCCATCTCAAAGGCGCCCAAGGCGATGCACTGCACGTGCTCGGCTGCGCCGCTGGCTACAACCTGCGCTGGCTGCTGCGCTGGATC
GCATTTTTGCGTGCTTGGTTGCAGGTGGTGCGGGCGCGTTCCTCAACGCCCTCAAGCACCATGTGGTCCGCAAACATGGCACTGGAGGTTTGAGAGGGGT
TTTTCAGGGGCGAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1377 bp458 aa1171493+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRTRRPAAEQLPADELFRSRLENQIDLRHPLVQLIHRLPWSALEQALSPRLPATPGTGGRPALPVRLIAGLLYLKHAYGLSDEAVCERWLENPYWQFFTG
EVVFQTCLPCDPSSLTRWRQRLGEAGMEELLAHTINTAHVMKAVDARELSRVIVDTTVQEKAIAHPTDSGLLEVARKKLVLLAKRHGIALRQSYARLGPA
LRRKAGRYAHARQFKRMRKVLRRQRTVLGRVLRDLQRKLARLEPSVHEGISVWLERAHRLLTQRPKDKQKLYALHAPEVECMSKGKARQPYEFGVKVGIA
VSARKGLIVGARSFPGNPYDGDTLAEQLEQARGLLQDVNVIPQVAIVDLGYRGRDVEGVQILHRGKANTLTRRQWRWIKRRQAVEPVIGHLKQDCRLNRC
HLKGAQGDALHVLGCAAGYNLRWLLRWIAFLRAWLQVVRARSSTPSSTMWSANMALEV

 

Blast result :
Comments
ISXca5 is 94% aa similar to ISXoo4.
References
1] ISfinder annotation (2010)
2] Thieme,F., Koebnik,R., Bekel,T., Berger,C., Boch,J., Buttner,D., Caldana,C., Gaigalat,L., Goesmann,A., Kay,S., Kirchner,O., Lanz,C., Linke,B., McHardy,A.C., Meyer,F., Mittenhuber,G., Nies,D.H., Niesbach-Klosgen,U., Patschkowski,T., Ruckert,C., Rupp,O., Schneiker,S., Schuster,S.C., Vorholter,F.J., Weber,E., Puhler,A., Bonas,U., Bartels,D. and Kaiser,O. (2005) J. Bacteriol. 187 (21), 7254-7266