ISTha3

  • Family IS91
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
EU327987 ND Thauera sp.
Thauera sp. E7
DNA section
IS Length : 2424 bp

Ends


oriIS : TTGAACTGAACCGCCGCTTAGGCGGTGATGCTGGGGATTCTACGCGCGCCTCATCCACATTGGATAGGGCGCGACTGGATCTTGGCATCAGCGAGTGGCC II struct. : No
terIS : GAATGCGGGGACATCCCCGGTTTCAAGGTAGGTCGGCGGCGCAGACGTCATGAAAAAACGCGGTGGCGCTTGGGTTCGCGGCCACCGCGTCAGCGGTTTA II struct. : No

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
AGGGATAAGC CTTGGTTC AACTTTGTTT

DNA sequence

TTGAACTGAACCGCCGCTTAGGCGGTGATGCTGGGGATTCTACGCGCGCCTCATCCACATTGGATAGGGCGCGACTGGATCTTGGCATCAGCGAGTGGCC
GGTCCCGGCTCAGCGCTCGCGACGATCGCCGTAATCGGCCGCAATCGAGTGCCGGGCGTGCGTCGGGCGTGCGGTGTCGGTCGCGTTCGCCAGTCTGGGA
ACGTGCCACGGCCTGCCGGTGCGAAAGCCGCATCAGCGAGGATTGAGACGGGGGCGCGTGAGTGTTCATCGCGGCCCATCCCGACAGCGCGGCGCCGGTG
CGGGCGGATCGTACCGGCGAGCCATGACGATCTCGACCGTGTCCCAACGCCCGACCCTACAGTGCGGGCAGCATCGCGGATCCTCCCCGCTGACGCGGGC
GAGGAAGTCCTCGGCTGAATAGATCACAGCCGCTTGTGGTGCCGGCGTCTGGAGTGCCGCACGGGCGGCGGCAAGCCGGGCCCGCTTGCGGCCGCAGGCG
AGCAGCCCGTAGTGGCGCAGGCGCTTGAAGCCGGCCGGCAGCACGTGGCGCAGGAAGCGTCCGATGAAGGTGTCGGTCGGCAGGCTGACCGTACGCTTGC
CGCCGGTCGCGTTGTCGCGCACCCGAAGGCGCACCTGCCCCACCTCGCAGCCGAGAAGGCGGTCGTTCGAGAGCGCCACGCGGTGCGTGTAACGGGCAAG
GTAGTCGAGCACTTGGGCGGGCCCGCCCGGCGGCGGCTTGGCGTAGACCACCCAGTCATGCACGAGCAGCGCACGGCGCCTGTCTTGCCATGCACCCGGC
GCACCTTGCGGATCGTCGGGCAGCTCGCCGCTGCGGTGGGCAGCGTCGAGCCGCGCGAGGAACTTGCCGCGAAACACCTTCGAGGCGGCCTGGATCGGAA
ACAGGAAGTGCGTGCCGCGTGCCGGTATGCGCCATCTGCCCTCGGCGTCGAGCCCGCCACAGGTGATCAGGGCGTGCACATGCAGGTGCACGCGCAGATC
CTGACTCCAGGTGTGGAGTACGAGGCTGAAGCCAGGCACGGCGCCCAGCCAGCGCGGGTTGGCGGCGAGCTCGAGCAAGGTGGCCGCCGCACTGTCGAAC
AACGCGCCGTAGAGCCAGCGCGGATGCCGGATCGCCAGTGGATTGAGCGCGTGGGGCAGCGTGAACACCCAGTGCGCGTAGGGCACCGGCAGCACTTCGC
GCAGGCGCGCCGCGCGCCAGGCCTCCTTGGCCCGCGTCTGGCACTGCGGGCAATGGCGGTTGCGACACGAACGCCAGACATGGCGCTCGGCGCCGCAGTT
TGCGCAACGCTCACGTAAGCCGCCGAGCGCCGCCGTACGGCAGTCGACGATCGCCCGCCAGGCCCGCGCCTGGGTGGGCGACAGAGCATGGCTCCGGCGG
TAGGTGCCGCCGTGCGTGCGCAGGATGCTGGCCAGCGTGGGCTGGTCCATGGCCGCTCGGCCTCAGAGCCGGCGCAGCAGATCGAGCGGGCTGTCGTGGG
CGACTGAACCCGGACGCGCCAGATGCAGGTAGCGCTGCGTGGTCGACAGGTGGCCGTGGCCCAGGAGCTTCGCGAGCGTGGCCAGATCGACGCCGGCCTC
GAGCAGATGGGTGGCGAAGGCGTGGCGCAGCGTGTGGATGCCGCCCGTCTTGGTGATACCAGCTCGGTCGCGGGCACGGTAGTACGCACGTTGCGCACTG
CTGATGTCGTACGGCTGGGCGGCGTCGGTGGCGCGAGGGAACAGCCAGACGCGGGGTTTGCAGATGCGCCAATAGACGCGCAGCGCTTCGAGCAGGCTCG
GGCTGAGCAGCGTGTAGCGATCCTTGCCACCCTTGCCCGCCACCACCCGGATGCACATGCGATCCGGTGCGCTGTCAATGTCGGCGACGCGTAGCGCGCA
CACCTCGGACACCCGCAGTCCGGCCGCGTAGGCCGTCATCAACAGTGTGCGCGCGCGCAGATTGGCGGCCGCCTCGAACAGTCGCGCCAGTTCCTCGCGC
GACAGGATCTCCGGCTGACGCTGCGGCGTGTGCGCGTAGGGAATCGTGATGGCCTCGGCCGTGCGGCCCAGCACGATATCGAAGAAGAACTTCAGCGCGC
ATACGGCCTGGTTCACGGTCGTGTAGGCCAGGTGCCGCTCGGTGATCCGGTGCAGCAGCCAGGCCTTGACATGCGCGCCATCGAGCCGGTCGGGGCTGCA
GTGGTAGTGCGCGGCCAACTGCGCGACCACCGACAGGTAGGCCTGCTGCGTGCGCCGTGCCAATCCGCGCAGCACCATCGCGTCGATCATCTGCTGACGT
AAGGGGTTCATGACACTTCTCCTTGAATGCGGGGACATCCCCGGTTTCAAGGTAGGTCGGCGGCGCAGACGTCATGAAAAAACGCGGTGGCGCTTGGGTT
CGCGGCCACCGCGTCAGCGGTTTA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1185 bp394 aa1450266-No
ORF function : Transposase
Chemistry : Y2

ORF sequence :

MDQPTLASILRTHGGTYRRSHALSPTQARAWRAIVDCRTAALGGLRERCANCGAERHVWRSCRNRHCPQCQTRAKEAWRAARLREVLPVPYAHWVFTLPH
ALNPLAIRHPRWLYGALFDSAAATLLELAANPRWLGAVPGFSLVLHTWSQDLRVHLHVHALITCGGLDAEGRWRIPARGTHFLFPIQAASKVFRGKFLAR
LDAAHRSGELPDDPQGAPGAWQDRRRALLVHDWVVYAKPPPGGPAQVLDYLARYTHRVALSNDRLLGCEVGQVRLRVRDNATGGKRTVSLPTDTFIGRFL
RHVLPAGFKRLRHYGLLACGRKRARLAAARAALQTPAPQAAVIYSAEDFLARVSGEDPRCCPHCRVGRWDTVEIVMARRYDPPAPAPRCRDGPR

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
849 bp282 aa23111463-No
ORF function : Accessory Gene
AG : IS91 integrase/resolvase

ORF sequence :

MNPLRQQMIDAMVLRGLARRTQQAYLSVVAQLAAHYHCSPDRLDGAHVKAWLLHRITERHLAYTTVNQAVCALKFFFDIVLGRTAEAITIPYAHTPQRQP
EILSREELARLFEAAANLRARTLLMTAYAAGLRVSEVCALRVADIDSAPDRMCIRVVAGKGGKDRYTLLSPSLLEALRVYWRICKPRVWLFPRATDAAQP
YDISSAQRAYYRARDRAGITKTGGIHTLRHAFATHLLEAGVDLATLAKLLGHGHLSTTQRYLHLARPGSVAHDSPLDLLRRL

 

Blast result :
Comments
ISTha3 is embedded within a class 1 integron gene cassette, e.g. associated to an attC recombination site.
ISTha3 is 56% aa (ORFA : the tranposase) and 61% aa (ORFB : the recombinase) similar to ISAzo26.
ISTha3 is not bracketed by DR but displays palindromic sequences that could account for its orIS (71-141) and terIS(2382-2414).
References