ISRf1

  • Family Tn3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
Y08939 ND Sinorhizobium fredii
Sinorhizobium fredii HH103
DNA section
IS Length : 1002 bp

Ends


IR Length : 29/33

IRL : GGGGTCGGTTCCGGTTCGGGGCGAAATGACACCGTAAGGACAAACTGCTC
IRR : GGGGTCAGTTCAGGTAGGGGGCGAAATGACACCTTAGCATCTATAACGGG

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GGGGTCGGTTCCGGTTCGGGGCGAAATGACACCGTAAGGACAAACTGCTCTGTCCCAATTGAACCATTGTAGATTTTGATGGCAGGATGCCCTGATTTGC
AGGGGCTTATTGGTGTCTAAAACAGACTACCCTTCTACTGGGACAACACAGCCGCATCCTTTTTGCGCAAGCATCTGCTTAAACAGGGCTATGGCGTGAA
AGAACTATCTTTTACCGTCCTGCTACTCACGTCTTTCCTTCCATCGGATGCGATATGTGGTTATGTCTTGGCCAAGGGCATGAGGGGTAAACGAATGTTT
GGTTTTGGAAGAAAGTTTGCTCCAGCGGATGTGGGGGCGACTGTACGCAGAAAACGCTACTTTTATATAGCGAGCCAGTGATGCTTGGTTTGATCAAACT
TGGATCGATTGACTTTTCCAACGACGATCGCGGCAGTAAGGTATTCGGATACTCACTGCTACTGAATACCGGTGCGACAACTCATTCCCTTGGTTTTGCA
TCATCTGAGGACGATCCGTTTCGATCAAGTCGATTTCCTGAAAGATCGCAAGCCTTTTTTGATAGCTTTGCTGAGGCTTATTCTAAAAAATTGGATATTC
CCATTCATTACGATTTTGACCACTGCGTTCAATTCGTCCTGAACGAAATCGCGACAAACGACAGTTATGCTGACACTAAAACATTCTACGGAAATGGGGC
TCGACAGTCACTGTATGCTGAGGTCGTTCGCTTCCTGGCATCCAAAACAGCTCCGGACCGTTTTAGCGCTTTGCAGCCATTCTCTCAGGTAGAGGAAGAA
AAATGGCATCACGTGCTTGAGGCGATAGAAGGGCTGGACCGATCATATCGGTGGTCAATCGAATGCTTCGACTTTGGTAAAATGAAACGAACATGAAGTT
TTTTCAGGGGCAGTAATCTGGGAGACATGTTTCCCACGATCGGCTTTGAGCCCCCGTTATAGATGCTAAGGTGTCATTTCGCCCCCTACCTGAACTGACC
CC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
516 bp170 aa381896+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLGLIKLGSIDFSNDDRGSKVFGYSLLLNTGATTHSLGFASSEDDPFRSSRFPERSQAFFDSFAEAYSKKLDIPIHYDFDHCVQFVLNEIATNDSYADTK
TFYGNGARQSLYAEVVRFLASKTAPDRFSALQPFSQVEEEKWHHVLEAIEGLDRSYRWSIECFDFGKMKRT

 

Blast result :
Comments
Only present in Sinorhizobium fredii HH103, not in other closely related strains.
References
1] Vinardell,J.M., Ollero,F.J., Krishnan,H.B., del Rosario Espuny,M., Villalobo,E., Pueppke,S.G. and Ruiz-Sainz,J.E. (1997) Gene 204 (1-2), 63-69.