ISPst2

  • Family ISL3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s) ISPs1
Accession numberTranspositionOriginHost
AJ012352 ND Pseudomonas stutzeri
Pseudomonas stutzeri OX1
Pseudomonas stutzeri M1
Pseudomonas stutzeri R1
DNA section
IS Length : 2984 bp

Ends


IR Length : 21/24

IRL : GGGTATCCGGAATTTCTGGTTGATAAAATGCCAAAGATGTAAAGAAGAAA
IRR : GGGTATACGGATTTAATGGTTGATGGGGCACCTTTACCCCACCAACCTGA

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GGGTATCCGGAATTTCTGGTTGATAAAATGCCAAAGATGTAAAGAAGAAAATCTTTCTCAGCGGATTATCTGATTGATCCTCTTCAGCCTACTCTACTGC
CAATTTTCTGTTTCCACCTTCGCCTGAGTCTTCATAGCGATGCTGACTAGGGAGGACAGCGAGAGCTGGGCAAGCGTCAAAGCGGTTTCTGGTTCATGCG
CAATCCGGACACCTGCACAACATTCCTCTTGTAAGAAACCGATCAAATTCTCTAGGTGCCCATACTCGGGTATACAGACAATCGTGCGGCTATGTTTCTC
CTGCCGGATCAGCCCTACCTTGGCCATGCGCGCAAGGTGATGTGATAGCGTCGAAGCAGGAATACCCAGCCCCTTCTGGATATCTCCGACCGAAGCCCCA
TCATGGCCAGCTTTGACCAGAAAGCGGAACACGGACAGTCGGTGACTATTCCCTAGCTCAGCTAAGCTGGCTGCAACCTTTTCGTGATCCATAGCACGCC
CCAATAATTCGATGTTTCTAGAATTATAGTTGACAGGTCGGATAAACGCAAGTAGCCTGCGTACATCATTTCGACAATACTAGAAATATAGGAGTAATAT
TGAATGTCATCTCAACTCCAAGACGCTCTAGGCATGTTCGCCTTTCTCGCTATCGAGCTATCGGTTTTATTCATTGGCATTAGCTTGCTGGTCGGAGTTC
TTCAACGTCACATCCCACCATCCAAGGTGGAAGCGTTACTGCCTTCCAGTGGGAAGCGAGGCTATTTTCTTGCTGCTGGTTTAGGAGCTATAACGCCTTC
TGTAGTTGCTCGACTATCCCCATGTTGAAAGGGTTGATTCGGGCACGGGCCGGTTTTGGGCCGATGATGGTGTTTCTTTTCTCATCTCCGTTGCTGAATC
CTATCGTCGTCGGGCTGCTGGTTGCCACGTTTGGATGGACACTTACTGCTAATCTATGTGCTCGCCGCTTTGGTGGTCGCGGTAGGTGCCGGATGGCTGC
TTCACACGCTTGGCTTCGAGCGTTTATTGTGCGCCGGACGGCGACACAAGAGAGCAGTGGATGTAGTTCATCAGAAGCCCGTGCAGTGCTACATCGACCG
CATCGAGTTGCGGCACCAACAGCTGCGACACCACTCCGAAGACGGCTTCTTGCGGGGCTGATAGGAAGACAACAGTCTCTACGTCTAGCGAATGCTGTGA
CAGTCAACCCACTGTCACGGTTAAGAAAGAAGGGAGTACAGTGGTGTGTGGCGGGAAGCTTGGTCGGACTTTATCGATGTGTTGCCTTACCTGCTCATCG
GTATTGCGATTGGCAGCGTGATCTATGGTTTCATGCCCACTGACTTATTGGAGCAGTATCAGGCCCAGATAACCCCTTTGCCATTCCAGTTGCCGCTGTC
ATCGGCCTGCCGTTGTATATCGCGCTGAAGCCGTCATACCTCTGGCAGCGGCTCTGATGGCCAAAGGCGTGGGTGCCGGGACGGTGCTAGCGTTTATCAC
GGCAGTGCCGGAGCCAGCCTGACTGAGCTCATTCTGTTGCGCTCTTTGTTCACGCTGAAGCTTTTAGCGGGCGTTTTTAGCAGTCATTTTTGCTATGGCG
ATGATTGCCGGTTACGCCACCTACCTGTTTTTCTGATCAAGGCGGGAGATGATTAATTCGTTAAGCCTTCCTGGGTACCAGTTGGTGGATTCTGATGAGC
AGAATGAAGACATACATTTTCGGCTTGAAGCACCTACACCAGTAGCCTGCGAGGGGTGCGGCGTGCAGGGTGAGTTCGTGCGGTTCGGCAAGCGTGACGT
TCCCTATCGTGATCTGCCCATCCACGGCAAGCGGGTCACTCTCTGGGTGGTCCGCCGCCGATACACTGCCGGGCCTGCAAGACAACATTCAGGGCCCCAG
CTACCGGAGATGGTGGACGGATTCCGTATGACACTGCCGCTGCATGAGTACGTGGAGAAGGAATCCTTCAACCACCCCTACACCTTTGTGGCGGCACAGA
CCGGCCTGGACGAGAAGACGGTGCGCGACATCTTCAACGCCCGCGCCGAGTTCCTGGGGCGCTGGCACCGCTTCGAGACGCCCCGCATCCTGGGCATTGA
CGAGCTATACCTGAACAAGCGCTACCGCTGCATTCTGACCAACATTGAGGAGCGAACCCTGCTCGACCTGCTGGCCACCCGCCGCCAGGACGTGGTGACC
AACTACCTGATGAAGCTGAAAGACCGGCAGAAGGTCGAGATCGTCAGCATGGACATGTGGAACCCCTACCGGGCAGCGGTCAAGGCTGTGCTGCCCCAGG
CCCGTATCGTGGTCGATAAGTTCCATGTGGTGCGCATGGCCAACGATGCCCTAGAGAGAGTGCGCAAGGGCCTCAGAAAGGAGCTGAAACCGTCCCAGAG
CCGGACTCTCAAGGGAGACCGGAAAATCCTGCTGAAACGCGCTCACGAAGTCTCAGACCGGGAGCGCCTCATCATGGAGACCTGGACAGGCGCGTTCCCG
CAACTGCTGGCCGCCTACGAGCACAAGGAGCGCTTCTACGGCATCTGGGACGCCACCACACGGCTCCAGGCAGAAGCCGCCCTGGACGAGTGGATAGCCA
CCATCCCGAAGGGCCAAAAGGAAGTCTGGAGCGATCTGGTCAGGGCAGTGGGAAACTGGCGCGAAGAGACCATGACCTACTTCGAGACGGACATGCCCGT
CACCAACGCTTACACGGAGTCCATCAACCGACTGGCCAAGGACAAGAACCGTGAAGGGCGCGGTTACTCCTTCGAGGTGATGCGGGCACGAATGCTCTAC
ACCACGAAGCACAAGAAGAAGGCACCGACTGCGAAGGTCTCTCCTTTCTACAAGAAAACCATCGGTTACGGACTGCCGGACTTCGCAGAGGAACTCAACT
ACGGAGTCGATCTATCAACCATCTGATAATGGTATCAGGTTGGTGGGGTAAAGGTGCCCCATCAACCATTAAATCCGTATACCC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
399 bp132 aa49294-No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MDHEKVAASLAELGNSHRLSVFRFLVKAGHDGASVGDIQKGLGIPASTLSHHLARMAKVGLIRQEKHSRTIVCIPEYGHLENLIGFLQEECCAGVRIAHE
PETALTLAQLSLSSLVSIAMKTQAKVETENWQ

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1278 bp425 aa16492926+No
ORF function : Transposase
Chemistry : Unknow

ORF sequence :

MINSLSLPGYQLVDSDEQNEDIHFRLEAPTPVACEGCGVQGEFVRFGKRDVPYRDLPIHGKRVTLWVVRRRYTAGPARQHSGPQLPEMVDGFRMTLPLHE
YVEKESFNHPYTFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRYRCILTNIEERTLLDLLATRRQDVVTNYLMKLKDRQKVEIVS
MDMWNPYRAAVKAVLPQARIVVDKFHVVRMANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIMETWTGAFPQLLAAYEHKERFYGIW
DATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGNWREETMTYFETDMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTAKVSPF
YKKTIGYGLPDFAEELNYGVDLSTI

 

Blast result :
Comments
ORF2 was 93% similar to Serratia marcescens IS1396. Another possible ORF was found (ORF1 : nucleotides 94 to 492, reverse) and the product showed a certain degree of similarity to bacterial transcriptional regulators.
ISPst2 is present in several copies in the genomes of the three strains.
In the original article the sequence was named ISPs1, a number which had previously been designated to.
References
1] Bolognese,F., di Lecce,C., Galli,E. and Barbieri,PAppl. Environ. (1999) Microbiol. 65 (5), 1876-1882