ISMasp4

  • Family IS66
  • Group ISBst12
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_008576 ND Magnetococcus sp.
Magnetococcus sp. MC-1
DNA section
IS Length : 1969 bp

Ends


IR Length : 19

IRL : GTAACCGTTCAGAGACCCCTCGTTCAGTGAGGATGTTCACCGTTTGAGAA
IRR : GTAACCGTTCAGAGACCCCGATATCAAGCGGCTACTGGAGCCGGTAACGG

Insertion site


Left flankDirect repeatRight flankDR Length
CGTAAACTCAGTCACATGTGCTACCTGC8
GTTATGCATTCACTGGTTTGTCTCAGGC8
GGCATTCTGTGGTTTGCTAGGTTTCCCC8
CTATATTCCCGTTTCTACAGGTTTGACC8
GCAAAAAACTGTCTGTTTTGGTGTTGCC8
GTTTTTTTGCCACCTACCCCCCTCTAGA8
GGGTATGTTTCCCTAAACGG0

DNA sequence

GTAACCGTTCAGAGACCCCTCGTTCAGTGAGGATGTTCACCGTTTGAGAAGGAGTCAACTGCCGGGAATAGCGCCAATTTTGTTTGACCATGGCAAAGAA
TATCCTTGACACGATTTTCGTCGAAAATGTGAAATTTCAGAAGGAGAGTGCGATCCGATCTGTTTTTGCCTATCAAAGCCTTGAGGAGAGTTCTGGCGGG
TTTTCAGCTGTGGCGCCCACCCCCGGGTACGAGCGAATTTTTGCGCTGGATCCAATGGGGCGCAGAAGCGCAAAAATCTCTTCCTGGAAACCCGTGTTAT
CATGTGTGCGAGGATTCATTCACCGGCGATGATGTGGTGCGCGAACCATGAAGCTTTCAGATCACGACCTGCTCCAGATTGATGAGGAATATCTCTCCTC
ACTATCGTCTGCAGAGTTACTGGCCGTCAGCCGGAAAATGTTGGAGGATCTCAAGGAATCTCGTGAGCGTTTGAACCGAACACCCGACAACAGTTCCCAG
CCGCCCAGCAGTCGTCCGGCGTACCTTGGGATTCCAGTTGAGCAAGACGAAACGCTTTCGGATGAGGATGAAGAGGACGTTTCGCCGGTGGAGAAGAAGG
GAACCGATGATGCGGATGGAGATGATTCACCAGGGCCATCCGGCAGTTCTACTCCCTCTGCTCCAGGAAATGGTAAGTCGGATTCCTCAGGCAAGAAGCC
GAAAGGCAGGGCTGGGAAGCCAGTTGGGGCCAAGGGATTCGGCAGAACGCAGATAATTCCGATTCGGAGTACCGTGGTTCATCGAGCGGAAACGTGTGCT
GCCTGCGATGCTGCCCTTCCCTTGGATGCTCGATTTACAGCTCGAATCGGCTATGTGACCATCGATCTGATAAGGGGTGCCCCGGATCAGCCTGGATTGA
GGCTAGAGGGGACCAAGCACCTTTTTGGGGAAGTTGCCTGTAGATGCGGCCATATTTCATGTACCGGTCCCGGCACAGGGGATAGACTTGAGATTGCAGG
ACGCAAAACCGCAACCAGTTTGAGTGAATGGCGTATTGTCGGCCCCATGTTGGCTGCTTTCATTGTTGCGCTCGCAAAACGGATGCGGTTGTCTCGCTCC
AAGGTTCAGGAGTTTTTGATCGATTGGTTCGGCCTGGAGTTGAGTGTCGGGACCATCGACAATTGCATACGTGAGGTCGGACTGGCTGCCGCCCCTGTTC
AGGATGAACTGATTGCCGAACTTCGTGCATCCGCTCTGGCTCATGTAGACGAAACGCCTTGGAAGCAAAAAGGTCAAGCTTTGTGGCTCTGGGTTTTCGC
GACGGCAAATACGGTCTTGTTTTGCGTGGGACGCCGGACTCGACAAATGGTCCTTGATATCCTGACCGAGGAATATGCAGGCTGGCTAATGAGCGATGGA
CTCATGAACTACCGGATTTTCTCCAGGCGGCTGCGCTGCTGGGCGCACTTGATCCGAAAAGCCAAGGGGTTGTCGACAAGCCTGGATAAAGAGAGCAAAC
GATTCGGCTCCAGGGTATTGGAGGTCCTGGAATACATGGTCGAAGAGGTCAAAGATGGATCGGATCCGCCAGCTGCCGAGTCGATTTTGGAAGAATTCCA
GGGATACTGCGAATTGTACAGAGATTATCCCCCGTCCGAGAAAGTTCGCAGCCTTGCCGTTGAGCTTCTCAATGACTGGGATGTTATCTGGCAACCTGTG
AGAGTTCCAGGGCTGCCGCTGACCAACAACGATGCGGAGCGGGCTCTGCGCCACTGGGTCATTGCGCGTCTGATCAGCCACGGAACTCGTACGGCAGAAG
GGAGTCGGGTATTGGGTGTGCTGGCTAGCGTCATCGAAACTTGCCGATTGCGGAACGTGTCTCCCTGGGACTATCTTGCTGAGGTGATTGCTGAACGGAG
AAAGGGAAACCTCGTACCGCCGTTACCGGCTCCAGTAGCCGCTTGATATCGGGGTCTCTGAACGGTTAC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
243 bp80 aa90332+No
ORF function : Passenger Gene
Annotation : Description :

ORF sequence :

MAKNILDTIFVENVKFQKESAIRSVFAYQSLEESSGGFSAVAPTPGYERIFALDPMGRRSAKISSWKPVLSCVRGFIHRR

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1599 bp532 aa3481946+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKLSDHDLLQIDEEYLSSLSSAELLAVSRKMLEDLKESRERLNRTPDNSSQPPSSRPAYLGIPVEQDETLSDEDEEDVSPVEKKGTDDADGDDSPGPSGS
STPSAPGNGKSDSSGKKPKGRAGKPVGAKGFGRTQIIPIRSTVVHRAETCAACDAALPLDARFTARIGYVTIDLIRGAPDQPGLRLEGTKHLFGEVACRC
GHISCTGPGTGDRLEIAGRKTATSLSEWRIVGPMLAAFIVALAKRMRLSRSKVQEFLIDWFGLELSVGTIDNCIREVGLAAAPVQDELIAELRASALAHV
DETPWKQKGQALWLWVFATANTVLFCVGRRTRQMVLDILTEEYAGWLMSDGLMNYRIFSRRLRCWAHLIRKAKGLSTSLDKESKRFGSRVLEVLEYMVEE
VKDGSDPPAAESILEEFQGYCELYRDYPPSEKVRSLAVELLNDWDVIWQPVRVPGLPLTNNDAERALRHWVIARLISHGTRTAEGSRVLGVLASVIETCR
LRNVSPWDYLAEVIAERRKGNLVPPLPAPVAA

 

Blast result :
Comments
ISMasp4 is 43% aa similar to ISStau2.
The ORFA is a passenger gene annotated as unknown protein.
References
1] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Kiss,H., Goodwin,L.A., Brettin,T., Bruce,D., Han,C., Tapia,R., Gilna,P., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N. and Richardson,P. (2006) Direct Submission GenBank.

2] ISfinder annotation (2008).