ISCARN110

  • Family IS91
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Metagenomic data
Metagenomic data from CARNOULES
DNA section
IS Length : 2294 bp

Ends


oriIS : GAAGCCGCTATCGCGGAGAAACACCCCTCAGCAACGTGATTCAATAACATAATTCATCCTCACCCCGAAAGGGAATTTTTTGTACTTTACCATGAGGATG II struct. : No
terIS : GACAGGTTGCTGCAAAGGCAACCTTGATGCGGTGAAATTCGGGGCGCGGTGAGTGACATGCCCCGGTGACACCGCAACGGTCAGAGAGATATTTCCATAA II struct. : No

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
CTCAACCGACTGGTT GAACCAAG CAGGTTCATGGCAGCCC

DNA sequence

GAAGCCGCTATCGCGGAGAAACACCCCTCAGCAACGTGATTCAATAACATAATTCATCCTCACCCCGAAAGGGAATTTTTTGTACTTTACCATGAGGATG
AAGCAGATGACGCCACAAATTCCAGCCCATTTCGAACAAAGCTATCAGCGGCTTCTCAACTGCCTGAAGCTCGCCGGGATGCAGCCTAAGACCATCGAGT
TGTATTCGCGCGGCGTGCGTCGGGCGGGGACGTATTTTGATTATCGGATCGATGATTTGACCAAACTTCAGTTGACCGAATATTTCGTACATATCCTCGA
TGTGCTGTCCTGGAGCGCGCTCAAGCACGACCTGTACGGGTTGAAGTTCTATTATGCCAAGGTGTTGGATAAACCTTGGCCGGGCGCGGATTTGGTCAAG
CCGCCCAAGTCGCACACGCTGCCGGATATTCTCACCGTGCCACAGGCCCAACAGATTTTCATGGCGACACGGGTGCTCAGTTATCGCGTGTTTTTCTTCA
CGTTGTACAGCCTGGGTTTGCGGCTCGGTGAAGGGTTGCGCTTGCAGGTCGGGGATCTTGATGCGGACCGGATGCGGGTGCAGGTGCGCAACGCCAAAGG
CAATCGCGACCGTTTCGTCCCGTTGCCGGAGAACACCTTGCAGGTGTTGCGCCGCTTCTGGCAGACCCACCGCAACCCCGCGTTGCTGTTCCCCAACCGC
AAGTGCGGCTTCAAAAAAGCGCACTTGGCCACCACCCCGCTGGATCGCGGCGGCGTCCAGGCCACCTTGCGCCAGGTCACCCGCGATTGCGGTTTAAAAA
AAGCATTACGCCGCACAGCCTTCGACACAGTTATGCAACTCACCTGATCGAAGCGGGCGTCGACCTGCTGGAAGTGCAAAAAATCCTCGGGCACCAATCC
ATCCTCACCACCCTCCGCTACACCCACCTCACCGAACAACAGCAACGCACCGCACAAGCACGTATCAACCAGTTGATGGGGCAAATCCAGATCAGTTGGG
GCAAGGTCAAATGATCCGGCTGGCGCACATTGTTGAAACCTATGCAACCGAGCTGATCGCGCAACAGGGCCATCGGCTGCTGCCCAGCCAATTGGCCGCG
TTAAGCGCCTTCCAACTATGCCGCAGCAGCATGAGTCCCAGAATGGAACTCGCCTGTGACGGCTGCACCGAACAGAGCTATTTGCCGCACTCCTGCGGGC
ACCGCAACTGCCCGCATTGCCAGGCGCACGAGTCGCAACGCTGGATAGATCAGCAGCTGCAAAAGCTGGTTCCCGGCAAGTACTTCATGGTGACGTTCAC
CTTGCCCGCCCAATTCCGCGCGCTGGCCTGGCAGCATCAGCGCGTGATGTATGAGCTGATCACCCGTAGCGCGTGGGAGACCGTCAACACCTTCAGCCAG
AATGACAGGAAGCTGCGCGGCACCACCGGTGCTGTGACCGTGCTGCACACCCACAGTCGCCGCCTGGACTACCATCCGCACGCCCATCTGGTCATGCCCG
CCGCCGCGTTCGACAATAAGCAGCGGCGGTGGCGCAACAAGGACGGCGGTTATCTGTTCGACCACAAGGCACTGGCGAAAGTATTCCGCGCCAAGATGCT
GGCGGGCATCAAACAAGCGGGATTGAAACTGCCGGATGCTTACCCCACCGAATGGGTGGTGGATTGCAAAGATGTCGGCTCAGGCCATCAGGCACTGGTT
TACCTCGGACGTTACCTGTACCGGGGCGTGATCCAGGAGAAAGATATCCTGTCCCACGACAATGGCCGGGTGACATTCCGCTACCAGAACAGCGAGACCA
AGCGGAGCGAAAGGCGCAGCGTGAGCGGCGTGGAATTTCTACGCCTGATCCTGCAACACATCCTGCCCAAGGGTTACCGCCGCGCCCGCAACTTCGGCTT
CTTGCACCCCAACAGCAAACTGATCCCGCTGGTGCAACTGCTCAAACGCGTCGTGCTTCCCCCGCCGCAACCGCGCCCGGCGATACGCTGCAAATGTTGT
GGCGGGACAATGAAAATCGTCCGTACCCGCATCAAGACATTCACCCAGCGATCGCGCACATCCGCGTCAAATAGGGAGACGGCCATGTAGCGCAACACCC
CCCGCCAGCCCGCCATACTTGGCAGGCATGGGCGCATTCGCCCTGCGAAAGGGTGAACTTGGGTAACAATGCTTAAAAAAGGCAGGTTGAGCGGGACAGG
TTGCTGCAAAGGCAACCTTGATGCGGTGAAATTCGGGGCGCGGTGAGTGACATGCCCCGGTGACACCGCAACGGTCAGAGAGATATTTCCATAA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
908 bp303 aa1071014+No
ORF function : Accessory Gene
AG : IS91 integrase/resolvase

ORF sequence :

MTPQIPAHFEQSYQRLLNCLKLAGMQPKTIELYSRGVRRAGTYFDYRIDDLTKLQLTEYFVHILDVLSWSALKHDLYGLKFYYAKVLDKPWPGADLVKPP
KSHTLPDILTVPQAQQIFMATRVLSYRVFFFTLYSLGLRLGEGLRLQVGDLDADRMRVQVRNAKGNRDRFVPLPENTLQVLRRFWQTHRNPALLFPNRKC
GFKKSALGHHPAGSRRRPGHLAPGHPRLRFKKSITPHSLRHSYATHLIEAGVDLLEVQKILGHQSILTTLRYTHLTEQQQRTAQARINQLMGQIQISWGK
VK

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1080 bp359 aa10112090+No
ORF function : Transposase
Chemistry : Y2

ORF sequence :

MIRLAHIVETYATELIAQQGHRLLPSQLAALSAFQLCRSSMSPRMELACDGCTEQSYLPHSCGHRNCPHCQAHESQRWIDQQLQKLVPGKYFMVTFTLPA
QFRALAWQHQRVMYELITRSAWETVNTFSQNDRKLRGTTGAVTVLHTHSRRLDYHPHAHLVMPAAAFDNKQRRWRNKDGGYLFDHKALAKVFRAKMLAGI
KQAGLKLPDAYPTEWVVDCKDVGSGHQALVYLGRYLYRGVIQEKDILSHDNGRVTFRYQNSETKRSERRSVSGVEFLRLILQHILPKGYRRARNFGFLHP
NSKLIPLVQLLKRVVLPPPQPRPAIRCKCCGGTMKIVRTRIKTFTQRSRTSASNRETAM

 

Blast result :
Comments
ISCARN110 is 61% (ORFA) and 57% (ORFB) aa similar to ISSde12. ISCARN110 encode both for an integrase (ORFA) and a transposase (ORFB).
References
1] ISfinder annotation (2009)