ISBusp1

  • Family Tn3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007509 ND Burkholderia sp.
Burkholderia sp. 383 chromosome 3
DNA section
IS Length : 3169 bp

Ends


IR Length : 14/23

IRL : GGGCCGCTCTCGTCATCGATGCGGAGTGGCTGATGGACCACTGGCGATTG
IRR : GGGGCGCCTTTGATTTTCATGCGTTTTTCCGGTTAGGCGCTTTTAGGCCC

Insertion site


Left flankDirect repeatRight flankDR Length
TCGCTACGCTCAATGCCAATG0

DNA sequence

GGGCCGCTCTCGTCATCGATGCGGAGTGGCTGATGGACCACTGGCGATTGGCTTATCTCGGGATCCGGCAGGTGCCGCGCGAGCTGAGCGAGTTCGAGCT
CGCCACATTCTTCACGTTCTCCAAGCGCGAGCGTGTTGCCATTGATTCACGACGCACCGATCTCTTTCGGCTCGCAGTCGCGTTGCACATCGGTTTTCTT
CGCATGACCGGTCGGCCGCTCGGCTCGTACAAGCAGATTCCCACGGTTCTCTGGCGACATCTTGGACGACAGCTGAATGTGAAGCCGCCAGACCTTGGCA
CTTTACGTTCACTTTACGATGGCAACCTCAAGACCTTATCCGACCACCAGCGCTTTGCTCGGGATGCCATCAATTTTCGAGCCGTCGCGGAACATCAACG
TCGGTATGTCATCCGTTGGCTCAAAGAACAACTCACCGGCCGCCCCGAACGCGGCCAGTTGACGAACGATCTCAAACGTTGGTTCTACGACCATCGCATC
GTGATACCACCGGAGCGCATGCTCAGGCAGTTTGTCGTCCAGGCCGTACGCGACATTGAGGGGCAACTGCATGGCGCGCTCGAGTCTGCCGTCGGTATGG
AAAAACTCGAGAGTTGGGCGCGAGTACTGGCGCAGCCCCATGGAGAACATTCAAGTCTCCAGCGGTGGCTGTGGGCCGTCCCGCTGCGCAACTCGACCCA
TCAGATGAGCGAGATCCTCGACAAAGTCAATTTGCTCACGATGCACGAGGTGGCAACGCGTTGGCCGGTTGAATGCAACGATGCCATGGTGCGCCACTAC
GCCCGCCGTTGTGCAAGCCGTCCGCCATCGATCAGCAAGCGAATCGAACCCCAAAGCCGACGAATCGAAGCCGCCTGCTTCATGCGGTATTCCCTCTGTA
TTGCGACTGATCAGGTACTCGAGATGCTCCGGCGATGGGTACTGAAGGTTGTCAACGACACGTCACGCGAAGTGGATGCGATGCGGATGAAGGCCGCGGA
TCAACTCCGCGAGTTCGCGCTTGCCGTCAAAGCACTTGCCAATGATGAAACCCTCTCGCGCGAACAGCTCGGGGAGAAGCTTTGTCTGCTTGCAGACGAT
GTTTTGCAACCGCATCCCACCAGCCGTCGGAGCCAGATCCGGCAGTGCCTGGTCCGAAAGCGGTACTACGCCCGTAACCTTTTGAATCGGATCGTGCAGC
TGCCGTTCGAGGCCGAGGGTGCTCATCCTGTAGTCGATGCGCTCTCGTTACTACGTGTGCTATATCGACGTCGCGCTTATCTCCTGCCCGACGGGGTCAA
TATCAGGCTTGGGCGCACGTGGCGCGAGGCGATCGATGGTTACGATCGGCTGCGGGCCATGGTTGCTTTCGAGTGGGCCACCCTCTTTGCGCTCCGTGTC
GCCCTGCGCAACGGCTCGGTTTTCATCAACCACAGCTTCTCGTTCAGAAGTCAGTCGCATATGCTGATCTCGCCCGAGCAGTGGCAGGCAAAGCGCAATA
ATCACTACGGACACCTCGGCCTGCCCCAAGACCCGAACGAATTTCTCGGGCCGATCCTTGAGCAGCTCGATAAGCGCCTTGCTCTACTCGACGATGCGGT
GGTCAATGGTTCGATCCGCGTGGATACTGCTGTCCACCTCGACCCGTTGGCTGCGCAGGATCCAGACGCACAAACCGATCAACTTCGCCGCCAGATCTTC
GAAGCACATCCGCCTGGCCAATTTCCCGAGATCATCCTCGAGATCGATAGTGCGACACGCTTCAGTTGGATCCTGCTCGGACGCGAGCCGCGGTCACGCA
CCGAGTTACTGATGGTGTATTCGGCGATACTGGCTCACGGGACCTCGCTGACGGCTGCTGATATTTCTCGGATGGTCCCGGAGGTGTCAACCGAAGCGAT
TCGCCAAATGATGAAGCGTCTCGCGGACGAACGAATGCTGCGTGCAGCCGCCGACGCCGTTCTCGAGTTCATGCACGAGCACCCAATCGCCGCCCACTGG
GGCCGAGCCGATCTCGCATCGTCTGACATGATGTCGCTGGAGACAACCCGGACGATTTGGCGAGCACGTGCAGACCCTCGTCGCCGTACGGCATCCATCG
GGATGTACACGCATGTGCTGGATCGTTGGGGCATTTTCTACGACCAGCCCATCATCCTGAATGAGCGACAAGCAGGCGCAGCAATCGAGGGCGTCGTCCG
GCAAAGCGCAACCAAGGACATCGCTCAACTCGCCGTCGATACGCACGGTTACACCGATTTCGCGATGGGCGTGTCCCGGGCACTTGGCTTTGATTTATGC
CCTCGCCTGTCACACCTTCGTGACCGACGTCTGCACGTGCCTCGCAGTCAGGTGGTGCCGGCGCGGCTCGCAGGGGTCACGGATCGCGACGTCCGACTCG
GTCTCATCGTTGACGTGTGGGACGAATTCGTGAGGATCGCCGCATCAATTCGCTCTGGCCAATGCACGGCGGTCGAAGCGATTGCCAGATTCGGATCAGC
TGCTCGAGGGCAGGCTGTGTACGATGGCGGCGTTCACATCGGCCGCCTATTCAGAAGTATTTTTCTGATCGACTACTTCACCAATGCCTCTTTCCGGTCG
GAGTTGCAACATGCCCTGAATCGGGGAGAAGCCGTGCATACCGTGCAACGCGCAATTCACATCGGTCGCATTCCGGTGGAGCTAGCTCGGCGCCAGGAAT
CGCTCGCGGCAGTGTCGTCGGCGTTGACCCTGCTCTCGAACATCTTGATGGCCTGGAATACCACCCACATGCAACGAGCCCTGGAGAACATCGAAGCTAC
CCGGGGGCAGCCGATCGCGGCCGAGCAACTCCGGCGAATCGCCCCAACTCATATCGAGGGCATCAACTTGCGCGGCACCTTCAATTTTCCCGTGTCACTG
TACGCAAAGCGGATCTTGCCGAGCATCGCGGCCGACAACCCCATTCCGTCAACCAGTCGGAGCGCCTAACGACGGGGTGAACTGGCGCCGCCGGTGAAGG
GACCTCTCATCTTCGATTCACCTCGTCCGGAGACACCCTCTGCTTCGATAGCGTAGGGTAGACACTAAGCCATTGTTTTATCGGAATTAATATTTAGGGC
CGCAAGGCAAGGCCTTGTCGGGCCTAAAAGCGCCTAACCGGAAAAACGCATGAAAATCAAAGGCGCCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
2937 bp978 aa332969+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDHWRLAYLGIRQVPRELSEFELATFFTFSKRERVAIDSRRTDLFRLAVALHIGFLRMTGRPLGSYKQIPTVLWRHLGRQLNVKPPDLGTLRSLYDGNLK
TLSDHQRFARDAINFRAVAEHQRRYVIRWLKEQLTGRPERGQLTNDLKRWFYDHRIVIPPERMLRQFVVQAVRDIEGQLHGALESAVGMEKLESWARVLA
QPHGEHSSLQRWLWAVPLRNSTHQMSEILDKVNLLTMHEVATRWPVECNDAMVRHYARRCASRPPSISKRIEPQSRRIEAACFMRYSLCIATDQVLEMLR
RWVLKVVNDTSREVDAMRMKAADQLREFALAVKALANDETLSREQLGEKLCLLADDVLQPHPTSRRSQIRQCLVRKRYYARNLLNRIVQLPFEAEGAHPV
VDALSLLRVLYRRRAYLLPDGVNIRLGRTWREAIDGYDRLRAMVAFEWATLFALRVALRNGSVFINHSFSFRSQSHMLISPEQWQAKRNNHYGHLGLPQD
PNEFLGPILEQLDKRLALLDDAVVNGSIRVDTAVHLDPLAAQDPDAQTDQLRRQIFEAHPPGQFPEIILEIDSATRFSWILLGREPRSRTELLMVYSAIL
AHGTSLTAADISRMVPEVSTEAIRQMMKRLADERMLRAAADAVLEFMHEHPIAAHWGRADLASSDMMSLETTRTIWRARADPRRRTASIGMYTHVLDRWG
IFYDQPIILNERQAGAAIEGVVRQSATKDIAQLAVDTHGYTDFAMGVSRALGFDLCPRLSHLRDRRLHVPRSQVVPARLAGVTDRDVRLGLIVDVWDEFV
RIAASIRSGQCTAVEAIARFGSAARGQAVYDGGVHIGRLFRSIFLIDYFTNASFRSELQHALNRGEAVHTVQRAIHIGRIPVELARRQESLAAVSSALTL
LSNILMAWNTTHMQRALENIEATRGQPIAAEQLRRIAPTHIEGINLRGTFNFPVSLYAKRILPSIAADNPIPSTSRSA

 

Blast result :
Comments
ISbusp1 is 65% aa similar to IS1071.
References
1] ISfinder annotation (2009)