IS5708

  • Family IS110
  • Group IS1111
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AJ010745 ND Klebsiella pneumoniae
Klebsiella pneumoniae KIIIA
DNA section
IS Length : 1364 bp

Ends


IR Length : 12/13

IRL : gaatggAAGGGACTTCCCCTAGATATGCGCCTGATTAATTTTCGTGCAAT
IRR : ---tatAAGGG-CTTCCCCGAACAGTCAACGCCGGTTTTTAATTTCTGTC

Insertion site


Left flankDirect repeatRight flankDR Length
NNNNCTTAACGTAGGATAAT0
NNNCTTAACGTAGGATAATT0

DNA sequence

GAATGGAAGGGACTTCCCCTAGATATGCGCCTGATTAATTTTCGTGCAATCATACGGATAAACATTGACCCAGAGGGATTCGTTATGACCATCACCACTG
TCGGTATCGATCTTGCTAAAAATGTGTTTGCTGTTCACTGCATTGACCAAAATGGTAAAGCTGTTCTGGTTAAACCCAAGGTGTCGCGTGCAGCACTTTC
TGAACTCATCGCAGGTTTACCTCCCTGTGTCATTGGAATGGAAGCCTGCTCGGGTGCCCACTATTGGGCAAGATTATTCAGGCAGTATGGCCATGATGTC
CGGTTGATGGCTCCGAAATTTGTCTCACCCTATCGCATGGCGGGTAAGACCGGGAAAAATGATGCAGCTGATGCAATAGCTATTTGTGAGGCAGTGCAGC
GGCCGCATATGCGCTTTGTACCAGTCAAAGACGAAAGCCAGCAGGCAATGCAATGCTTACATCGGACAAGACAGGGATTTATCCAGGAAAGAACAGCAAC
GTATAACCGTCTTCGGGGCCTGATATCTGAATTCGGGGTTATTGCCCCACAAAGCACTGATGCTCTGCGTCATGTTGTTTCTGACCAGAAGGAAACTCTG
CCAGTACAGGTCAGGCTGTGCATTGATGATCTATTGACACATGTCACTAATATTGAAGAGAAAATCGCCGAATATGACAGGGTATTATCTCGTGTGGCCA
AAACAGATCATCGCAGCCAGCAGTTAATGGAACTGAAAGGTGTTGGGCCCACCACAGCGAGTGCGCTGGTCGCCAGTATTGGCAATGCCCATGATTTTAA
GAACGGGCGCCAACTGGCAGCCTGGTTGGGGCTAACGCCATCACAATACAGTAGTGGCGGAAAATCAAAGCTTGGCAGGATAACAAAAGCGGGTGATGCC
TATCTGCGAACCCTACTGGTCCAGGGAGCCCGTTCTGTAATGGTAGGGGCAGAGAATAGAACGGACCCGTTTAGCCGTTGGGTCTGCTCGTTGATTGGTA
GGCGGGGATACTGGCGTGCTGTCGTTGCAATCGCCGCCAAGAATGCGAGGTTGTGCTGGGCATCATTACATTACGGCGATGACTTCAGACTGTATTCAAC
AACATGAAAAATTTAACTGAGTAGTAACTGAACTGTAAATTGTTGATGGTAAAGGGTTAGACCCCCGTGAGAAGTATCTGCATATCCTACTGGATATCAC
TATCCGATTAACGAAGGAGGATCTCACGAGCGTCTTTCATCAGGGTCCGAATCACTAGCGATTCAGCATGACCGTTTATAGTAGCGCAGTCTTATCCCTT
GCCTTTCATTGATGAACAGACAGAAATTAAAAACCGGCGTTGACTGTTCGGGGAAGCCCTTATA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1023 bp340 aa851107+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MTITTVGIDLAKNVFAVHCIDQNGKAVLVKPKVSRAALSELIAGLPPCVIGMEACSGAHYWARLFRQYGHDVRLMAPKFVSPYRMAGKTGKNDAADAIAI
CEAVQRPHMRFVPVKDESQQAMQCLHRTRQGFIQERTATYNRLRGLISEFGVIAPQSTDALRHVVSDQKETLPVQVRLCIDDLLTHVTNIEEKIAEYDRV
LSRVAKTDHRSQQLMELKGVGPTTASALVASIGNAHDFKNGRQLAAWLGLTPSQYSSGGKSKLGRITKAGDAYLRTLLVQGARSVMVGAENRTDPFSRWV
CSLIGRRGYWRAVVAIAAKNARLCWASLHYGDDFRLYSTT

 

Blast result :
Comments
The IR of this IS are not at its termini. In the IS sequence as given 6 nt separate IRl from the left-hand end of the element and 3 nt separate IRr from the right-hand end. The first residue of the sequence may in fact belong as the final residue, giving 5 nt on the left and 4 on the right.
Found Tn5708.

IS5708 is inserted within a putative 38 bp transposon TIR sequence, one side of the 7th base in from the end of the transposon.

The transposase protein is 88% identical to that of IS1618 from Yersinia pestis.

By analogy with IS4321, IS5708 may exist in a circular form in which a -10 region created by the abutted terminal sequences and a -35 region located just inside the right-hand end of the element are correctly spaced to form a promoter.
References
1] Albiger et al. unpublished
2] Partridge and Hall (2003) J. Bacteriol. 185, 6371-6384