IS408

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AB182267 Y Burkholderia cepacia
Burkholderia cepacia ATCC17616 plasmid pTGL1
Burkholderia multivorans ATCC17616
DNA section
IS Length : 2798 bp

Ends


IR Length : 39/47

IRL : TGCGTATTCCGGCGAACGTGATCACGCATTTCGGCGGATCGTGATCATGG
IRR : TGCGGATTTCGGCGATGGTGATCAATCGTTTCGGCGAACGTGATCAGTCT

Insertion site


Left flankDirect repeatRight flankDR Length
GTATGTGGTGGATGAAGCAATATTGAAA8
NNNNNNNNNNGCTGATANNNNNNNNNN7

DNA sequence

TGCGTATTCCGGCGAACGTGATCACGCATTTCGGCGGATCGTGATCATGGATTCCGAATGATCGTGATCACCCGTTTCGGTTGATCGTGATCGCTGATCA
CAGGTTTCCGAAACGCGTGATCACGATGCCGGAATGAGCGATCACGGGACCGAAACGGGTGATCACGTAACCGGAACGTAATCCGGGTTTGAGTCTGGCG
GTGGCGTTGCGCATGTATTCACCGACGGCGTTAGCCTGCTCCCTTTTTTGCGGGAGAAGTGCCGATGCCGACACCTCGGATGAGCATGCGCAAATTGAAG
GAAGTCCTGCGACTAAAGTGGGCGTGTGGCCTGACGCATCGGCAGATCAGCCGGGCTATCGGCATCAGCGTCGGTGCCGTCTCGAAGTTCGCGGCCCAAG
CCAGCCAGGCGGGACTCGATTGGGCGGCAGCCGAAGCAATGTCCGACGACGAACTGGACGCGCGCCTGAGGCCTGCGGCAACCAATGCCGCGGCGACGAC
GACGCGACGCATCGAGCCCGACTACACGGCATTGCATCGCGAGCTGCGCCGCAAGGGCGTGACGCTGCAACTGCTGTGGGAAGAATACGCTGAAGCGAAC
CCCGGCCAGCGGACGTACCGCTACACGCAGTTCTGCCAGAAGTACAAGGATTGGGCGAAGTCGATCAAGCGCTCGATGCGTCAGCAGCACCGCGCCGGCG
AGAAGCTGTTCGCGGACTTCGCGGGTCCCACCGTGCCGGTCCTGGCGAGCGATGGCGGCGTCGAGTTCGAGGCGCACGTGTTCGTTGCCGTGCTCGGCGC
ATCCAACTACACGTTCGCGTGCGCGACGCGCACCGAGACGATGGCGGACTGGATCGGCAGCCTGTGCGATGCGCTAGAGTTCATTGGCGGCGTGCCCGAG
CTGCTCGTGCCCGACAACCCGAAGGCGCTGATCGCGCGACCCGACCGTTACGAACCCGGACTCGGCACGACCACGCAGGACTTCGTGAACCACTACGGCA
CCGCGATGCTGCCGGCGCGTCCGCGCAAACCGCAGGACAAGGCCAAGGTCGAAGTCGGCGTGCAGATCGTCGAGCGCTGGGTGCTGGCCCGACTGCGCCA
CTATCGCTTCTACAGTCTGGCTGAACTCAACAAGGCGATTGCAGAACTGATCGCCGACCTAAACCAGCGCCCGTTCAAGCGGCTCGAAGGCAACCGGCGT
GAATGGTTCGAACGGCTGGACCAACCCGTCCTGCGCCCGTTGCCCGTGCGTCGCTACGAGATCGCCACCTTCCAGAAGTGCCGTGTGAACATCGATTACC
ACGTCGATGTCGGCGGCCACTATTACAGCGTCCCGCATAGCCTCGCACGGCAGGAGGTCTGGGCGCGTATCACACGCCACGGCGTAGAGATCCTGCATGG
CGGCAAGCGTGTCGCTGCGCACGCTCGCTCGCGCCTCAAAGGCAAACACACGACCATCGCCGAACACATGCCGGCTGCGCATCGCGCGCACATGGAATGG
ACGCCTGGGCGCCTGCTCAACTGGGGCGCATCCGTCGGCCCCGGCGCCGAGGCTGTCGTGCGGCATCTGCTGACCAACAAACCTCACCCCGAGATGGGCT
ATCGCGCCTGTCTCGGTCTTCTCTCGCTCGCGCGCAAGTACGGCAAACACCGCCTCGAGGCCGCATGCCAGCGTGCATTGAAGATCGGCTCGCCCACGCG
TCGCTCCGTGCTGTCAATCCTGGAAGCGGGACTTGACCTGCAGCCCTCGCTCCCGACCACGCCCGCCGAATGGCGCTCGCCCGAGCACGAGAACGTGCGC
GGCCCCGACTACTACCACTGACCCGAAGGAGGTCACGATGTTGATGCAGCACACCCTTACCCAGCTAAAGGCGCTCAAACTGGACGGCATGGCTCGCGCG
TTCGAGGAGCAGTCAACGCTCACGGCAAGCACCAGCCTGTCATTCGAGGAACGCGTGGGCATGCTCGTAGATCGCGAGCTGGCCTGGCGTGATACGCGAC
GACTCGAACGTTTGCTGCGCGCCGCGAAGCTCAAGAACCCACAGGCCTGCGTCGAAGACATTGAATACCGGCAAACCCGTGGGCTGGACCAGCGCATCGT
CGCCACGCTCGCCGGCTGCGACTGGGTGCGCAATGCTCAGAACCTGATCCTGACCGGCCCCACCGGCGCGGGCAAGACGTGGCTCGCTTGCGCGTTCGGC
CAGCAGGCGTGCCGGCAGGGCTTCTCCGTGTTCTATGTGCGCGTCGCGCGGCTGTTCGAAGAGCTGAAAATCGCGCACGGCGACGGCAGCTTCACACGTC
GGCTTGCGCAACTCGCGAAGATTGATGTGCTGATCCTCGACGATTGGGGCTTGCAGGATCTCGACCAGGCGGCGCGCAATGATCTGCTTGAGGTACTTGA
TGATCGTGTCGGTACGCGCTCGACTGTGATCACCAGCCAGTTGCCGCTCGAACACTGGCACGCGTGGCTGCAGGACCCCACGCTCGCCGATGCGATTCTC
GATCGGCTCGTGCATCAGGCCCACAAGCTTCCGGTCAAGGGCGATTCGATGAGAAAGAAAACGAAATCCGAGTCCGCTGACGCCTGATCGTGATCACCGT
CGCTATAATCCATTGACCGCGCAACACCACCTTCCAGACTGATCACGTTCGCCGAAACGATTGATCACCATCGCCGAAATCCGAGTCCGCTGACGCCTGA
TCGTGATCACCGTCGCTATAATCCATTGACCGCGCAACACCACCTTCCAGACTGATCACGTTCGCCGAAACGATTGATCACCATCGCCGAAATCCGCA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1557 bp518 aa2651821+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MPTPRMSMRKLKEVLRLKWACGLTHRQISRAIGISVGAVSKFAAQASQAGLDWAAAEAMSDDELDARLRPAATNAAATTTRRIEPDYTALHRELRRKGVT
LQLLWEEYAEANPGQRTYRYTQFCQKYKDWAKSIKRSMRQQHRAGEKLFADFAGPTVPVLASDGGVEFEAHVFVAVLGASNYTFACATRTETMADWIGSL
CDALEFIGGVPELLVPDNPKALIARPDRYEPGLGTTTQDFVNHYGTAMLPARPRKPQDKAKVEVGVQIVERWVLARLRHYRFYSLAELNKAIAELIADLN
QRPFKRLEGNRREWFERLDQPVLRPLPVRRYEIATFQKCRVNIDYHVDVGGHYYSVPHSLARQEVWARITRHGVEILHGGKRVAAHARSRLKGKHTTIAE
HMPAAHRAHMEWTPGRLLNWGASVGPGAEAVVRHLLTNKPHPEMGYRACLGLLSLARKYGKHRLEAACQRALKIGSPTRRSVLSILEAGLDLQPSLPTTP
AEWRSPEHENVRGPDYYH

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
750 bp249 aa18382587+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MLMQHTLTQLKALKLDGMARAFEEQSTLTASTSLSFEERVGMLVDRELAWRDTRRLERLLRAAKLKNPQACVEDIEYRQTRGLDQRIVATLAGCDWVRNA
QNLILTGPTGAGKTWLACAFGQQACRQGFSVFYVRVARLFEELKIAHGDGSFTRRLAQLAKIDVLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITS
QLPLEHWHAWLQDPTLADAILDRLVHQAHKLPVKGDSMRKKTKSESADA

 

Blast result :
Comments
IS408 was originally detected in Burkholderia cepacia as an insertion into the lacZ gene of Tn951, on the broad host-range plasmid pGC91.14 (Wood et al., 1990). On pTGL5, IS408 is located 91 bp from IS401. Although both ends of been sequenced, less than 5 % of IS408 remains to be determined, at the 3' end of the element (Byrne and Lessie, 1994). IS408 contains at least three 23-bp terminal repeats (L1, L2, L3, R1 and R2):
L1: TTCCGGCGAACGTGATCACGCAT (7-29)
L2: TTCGGCGGATCGTGATCATGGAT (30-52)
L3: TTCGGTTGATCGTGATCGCTGAT (76-98)
R1: TTTCGGTGATGGTGATCAGGCGT (7-29) CS
R2: TTCGGCGAACGTGATCAGTTTG (30-51) CS
References
1] Gaffney, T.D., and Lessie, T.G. (1987) J. Bacteriol. 169, 224-230.
2] Wood, M.S., Lory, C., and Lessie, T.G. (1990) J. Bacteriol. 172, 1719-1724
3] Byrne, AM., and Lessie, T.G. (1994) Plasmid 31, 138-147.
4] Yoshiyuki Ohtsubo, Hiroyuki Genka, Harunobu Komatsu, Yuji Nagata, and Masataka Tsuda (2004)
Applied and Environmental Microbiology, in preparation. High-Temperature-Induced Transposition of IS Elements in Burkholderia multivorans ATCC 17616