IS1S

  • Family IS1
  • Group
MGE type ISRelated element(s) :
Isoform IS1ASynonym(s)
Accession numberTranspositionOriginHost
M37615 ND Shigella sonnei
Shigella sonnei
DNA section
IS Length : 768 bp

Ends


IR Length : 18/23

IRL : GGTGATGCTGCCAACTTACTGATTTAGTGTATGATGGTGTTTTTGAGGTG
IRR : GGTAATGACTCCAACTTATTGATAGTGTTTTATGTTCAGATAATGCCCGA

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GGTGATGCTGCCAACTTACTGATTTAGTGTATGATGGTGTTTTTGAGGTGCTCCAGTGGCTTCTGTTTCTATCAGCTGTCCCTCCTGTTCAGCTACTGAC
GGGGTGGTGCGTAACGGCAAAAGCACTGCCGGACATCAGCGCTATCTCTGCTCTCACTGCCGTAAAACATGGCAACTGCAGTTCACTTACACCGCTTCTC
AACCCGGTACGCACCAGAAAATCATTGATATGGCCATGAATGGCGTTGGATGCCGGGCAACTGCACGCATTATGGGCGTTGGCCTCAACACGATTTTACG
TCACTTAAAAAACTCAGGCCGCAGTCGGTAACCTCGCGCATACAGCCGGGCAGTGACGTGATCGTCTGCGCGGAAATGGACGAACAGTGGGGCTATGTCG
GGGCTAAATCGCGCCAGCGCTGGCTGTTTTACGCGTATGACAGTCTCCGGAAGACGGTTGTTGCGCACGTATTCGGTGAACGCACTATGGCGACGCTGGG
GCGTCTTATGAGCCTGCTGTCACCCTTTGACGTGGTGATATGGATGACGGATGGCTGGCCGCTGTATGAATCCCGCCTGAAGGGAAAGCTGCACGTAATC
AGCAAGCGATATACGCAGCGAATTGAGCGGCATAACCTGAATCTGAGGCAGCACCTGGCACGGCTGGGACGGAAGTCGCTGTCGTTCTCAAAATCGGTGG
AGCTGCATGACAAAGTCATCGGGCATTATCTGAACATAAAACACTATCAATAAGTTGGAGTCATTACC
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
276 bp91 aa56331+No
ORF function : Transposase
Description :

ORF sequence :

VASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSGRSR

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
525 bp174 aa229753+No
ORF function : Transposase
Description :

ORF sequence :

YGHEWRWMPGNCTHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPF
DVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
698 bp232 aa56753+Yes
ORF function : Transposase
Description :

ORF sequence :

VASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKKLRPQSVTSRIQPGS
DVIVCAEMDEQWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQH
LARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ

 

Blast result :
Comments
Additionnal Accession number : AF294823. This sequence is 100% aa similar to the sequence of the database.
The third ORf is the probable ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Ohtsubo, E., Ohtsubo, H., Doroszkiewicz, W., Nyman, K., and Davison, D. (1984) J. Gen. Appl. Microbiol. 30, 359-376.
2] Matsutani, S., Ohtsubo, H., Maeda, Y., and Ohtsubo, E. (1987) J. Mol. Biol. 196, 445-455.
3] Xu,D.Q., Cisar,J.O., Ambulos,N. Jr., Burr,D. and Kopecko,D.J. (2000) Direct submission GenBank.