IS195

  • Family IS982
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
U83995 ND Porphyromonas gingivalis
Porphyromonas gingivalis
DNA section
IS Length : 1070 bp

Ends


IR Length : 12

IRL : ACGTCAGTTCGACGAAGTAAAACGCCAATGAATTTGTTTTCTGATTAGTG
IRR : ACGTCAGTTCGATCTAAGCGGAAATAGGAAAGTTAGGGTTTCTGATGATT

Insertion site


Left flankDirect repeatRight flankDR Length
CACAGAATATTATCGTTACAGGACAGGG8

DNA sequence

ACGTCAGTTCGACGAAGTAAAACGCCAATGAATTTGTTTTCTGATTAGTGGTAAACGCCCAAAGAACGTGGGCATTATACTTGAAAAAGTAGCGAATTAT
TTGTATCTTAGCAGTTGACAATCAATAAGATACGAACAAACAAAACGCTACTTTATGAAGACAAATATAGTTGATGTTTTTTGCATCATAGATGATTTCT
CCAAGCTTTTTGATGAAACAATCAAGAAAAAGACCCTCGAAGAGGCAGACAAAAAACGCAGGAATAGAAAGTTTAAGATGTCGGACAGTGAGGTCATGAC
CATCCTGATCCTGTTTCATCTGTCAAGATACCGAGATTTGAAAGCTTTTTATCTTCAATACATCACCCACTCGTGTCGATCCGAGTTCCCACATCTTGTC
TCTTATAATCGCTTTGTGGAGCTGCAAAGCAGGGTAGGTTTCAAGCTGATAGCATTTCTCAATATGTGTTGTTTGGGTCAATGTACTGGCATCTCTTTCA
TCGATTCCACCCCATTGAAGGCTTGTCATATCAAACGAGCTCATGGGCATAGGACGATGAGGGGATGGGCTCAAAAAGGCAAAAGCACCATGGGTTGGTT
TTATGGATTCAAACTACATATTGTTATCAACGACAGGGGTGAAATCATCAACTATCAAATCACACCGGGCAATTGTGATGACAGAGAACCTCTGAAAGAC
GGAACATTCACCAAGAATCTTTTTGGCAAACTCATTGCCGATAGAGGCTACATTTCCCAAAACCTTTTTGACCGGCTCTTTGTCGATGACATCCACATGA
TAACCAAAATCAAAAAGAACATGAAGAACTCCCTGATGCATCTATATGACAAAGTTTTATTGAGAAAGAGAGCCCTGATCGAAACGGTCAATGATATGCT
CAAAAATGTCTGTCAGATAGAGCACACGAGACATCGCAGTGTCAACAATTTTGTCACCAACCTGATCTCCGGTATCATCGCTTACAACATCCTGCCTAAA
AAGCCTGAACTCAATATTGAAATCATCAGAAACCCTAACTTTCCTATTTCCGCTTAGATCGAACTGACGT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
903 bp300 aa1761078+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKTNIVDVFCIIDDFSKLFDETIKKKTLEEADKKRRNRKFKMSDSEVMTILILFHLSRYRDLKAFYLQYITHSCRSEFPHLVSYNRFVELQSRVGFKLIA
FLNMCCLGQCTGISFIDSTPLKACHIKRAHGHRTMRGWAQKGKSTMGWFYGFKLHIVINDRGEIINYQITPGNCDDREPLKDGTFTKNLFGKLIADRGYI
SQNLFDRLFVDDIHMITKIKKNMKNSLMHLYDKVLLRKRALIETVNDMLKNVCQIEHTRHRSVNNFVTNLISGIIAYNILPKKPELNIEIIRNPNFPISA

 

Blast result :
Comments
The ends of the element have been reinterpreted with respect to the published article. An "A" has been included at the 5' and a "T" at the 3' end. This removes an ambiguity in the original interpretation.
References
1] J.P. Lewis and F. L. Macrina (1998). Infect.and Immunity, 3035-3042