IS1549

  • Family IS1634
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP000480 Y Mycobacterium smegmatis
Mycobacterium smegmatis LR222
DNA section
IS Length : 1640 bp

Ends


IR Length : 13/14

IRL : CCTGACTTGGCTCACGGTTTCCGGTTTGGGGTAGTGGCGGGTTCTTGACC
IRR : CCCGACTTGGCTCAAATTAGTGTGCACCGTCGGCGCGGATCTTGATGAGG

Insertion site


Left flankDirect repeatRight flankDR Length
CTCCACGGTCAGCGGGATTCCAGCCGGCCA0

DNA sequence

CCTGACTTGGCTCACGGTTTCCGGTTTGGGGTAGTGGCGGGTTCTTGACCTGCAGTTTCGGAGTCGGCTCGGCCGGAATTTGCGCACTAAGGTCGGGCCG
TAGGCTGCCCTGGTGGCGTACGTGCGCACAGTGAAGACCGCTTCGGGGGCCACTGCGGTGCAGATCGTGTGGTCCACCCGACGCGGGTCACGCAACATCG
AGCATGTGGGCTCGGCCCATGATGAGGCCGAGCTCGCAGCGCTCAAGGCCTCCGCTGCCGAGCGGTTGGCGGCCAACCAGGCGGTGCTGGATCTGGAGGT
GTCCCCGCCGGCCGGTTCGGAGCCGTTGCCGATCACCTCCTCACAGATGACCCATCTGTGGGACGGGCTCTGTTCGGCGTATCGGATCCTCGGGTTCGAC
TCAGCCGCCGAGGGCGACAATGTGTTTCGGGATCTGGTGCTGGCCAGGATCATCGAACCCAGCAGCAAGGCCGACGCCGGACGGGTGCTCACCGAGGTCG
GTGTCGAACCGGCCTCCTATGCCACGGTCAAACGCCGGCTGCCGATCTACGCCCAGCCGCAGTGGCGGCAGTCCTTGGCCGCGGCCAGTGCACGTCGCGC
CGGGTTGGGGCCCGCATCGCTGGTGCTATTCGATGTGAGCACCTTGTATTTCGAGACCGACGCCGGCGACGGCTTCCGCGAGCCCGGATTCTCCAAGGAA
CGCCGACTCGAGCCGCAGATCACCCTGGGGTTGCTTACCGATGCCGCCGGGTTCCCGCTGACCGTGGAGGCCTTCGAGGGCAACCGCGCCGAGACCGCCA
CCATGCTGCCGGTGATCAACGCGTTCAAGGCCGCCCATCAACTCACCGATGTCACCGTGGTCGCCGATGCGGGCATGATCTCCGAGGCCAACCAGGTCGC
GCTGCAGTCCGCCGGCCTGTCCTACATCCTCGGCGCCAAGATTCCGTTCCTGCCCGATGTGGTGCGCGAATGGCGGGACAAACACCCCGACGAGGCGATC
CCCGATGGCCTGGTGCTCACCCAACCGTGGCCGGCCACCAGCAGCGAGAAGGCCCGCGGCATCCCGGACCGGGTCATCCACTACCAATTCCGCCACGACC
GCGCCCGGCGCACCCTGCGCGGCATCGACGAGCAAGTGGCCAAGGCCCAGCGCGCAGTCGACGGGCACGCCCCGGTCAAGCGCAACCGCTACATCCAACT
CACTGGCGCCACCAAGTCGGTGAACCGCACGCTGGAGGCCAAGACCCGCGCCCTGGCCGGCTGGAAGGGCTACACCACCAACCTCGTCGGGCAGCCCGCG
TCGTTTGTCATCGATGCCTATCACCAGCTCTGGCACATCGAGAAGGCCTTCCGGATGTCCAAGCACGACCTGCAGGCCCGCCCGATCTACCACCATTTAC
GCGAATCGATCGAAGCCCACCTGAGCATCGTGGTCGCCGCAATGGCCGTCAGCCACTTCATCGAGACCCAAACCGGCTGGAGCATCAAGAAATTCGTCCG
AACCGCACGCCGCTACCGCACCGTGAAGATCAAGGCCGGCACCCAGACCCTCACCGCCGCCGACCCGCTACCCGAGGACCTACGAGCAGTCCTCATCAAG
ATCCGCGCCGACGGTGCACACTAATTTGAGCCAAGTCGGG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1467 bp488 aa1581624+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLDLEVSPPAGSEPLPITSSQMTHLWDGLCSAYRILGFDSAAEGDNVFRDLVLARIIE
PSSKADAGRVLTEVGVEPASYATVKRRLPIYAQPQWRQSLAAASARRAGLGPASLVLFDVSTLYFETDAGDGFREPGFSKERRLEPQITLGLLTDAAGFP
LTVEAFEGNRAETATMLPVINAFKAAHQLTDVTVVADAGMISEANQVALQSAGLSYILGAKIPFLPDVVREWRDKHPDEAIPDGLVLTQPWPATSSEKAR
GIPDRVIHYQFRHDRARRTLRGIDEQVAKAQRAVDGHAPVKRNRYIQLTGATKSVNRTLEAKTRALAGWKGYTTNLVGQPASFVIDAYHQLWHIEKAFRM
SKHDLQARPIYHHLRESIEAHLSIVVAAMAVSHFIETQTGWSIKKFVRTARRYRTVKIKAGTQTLTAADPLPEDLRAVLIKIRADGAH

 

Blast result :
Comments
IS1549 was serendipitously discovered as an insertion element upstream the Tn5 aph gene. Five copies of IS1549 were found in Mycobacterium smegmatis LR222 (Plikaytis et al., 1997).
IS1634 is 53% aa similar to ISMsm6.
References
1] Plikaytis, B.B., Crawford, J.T., and Shinnick, T.M. (1997) ASM Meeting on Tuberculosis, July 8-12, 1997.
2] Plikaytis, B.B. (1997) personal communication.