IS1138B

  • Family IS3
  • Group IS150
MGE type ISRelated element(s) :
Isoform IS1138Synonym(s)
Accession numberTranspositionOriginHost
Z16416 Y Mycoplasma pulmonis
Mycoplasma pulmonis KD735-26
DNA section
IS Length : 1288 bp

Ends


IR Length : 18

IRL : TAAACTGGGACAAAAAAATAAAAAACACTTTTTAAAATATACTTTAAATA
IRR : TAAACTAGGACAAAAAAAGTGACTATTTAAAAAACACTTAGAACATCTCA

Insertion site


Left flankDirect repeatRight flankDR Length
NNNNNNNNNNTTCNNNNNNNNNN3

DNA sequence

TAAACTGGGACAAAAAAATAAAAAACACTTTTTAAAATATACTTTAAATAGGAGTGTTTATGAAACAACTAAAACCAGAACAATGAAAGAAATGATTTTC
ATTATATGAAGAATTTTATGATGGAAAAATTAATATAAAAAAATATATATTTTTAGTAAACAAAAATATTGGTAAAGATTGAAAAAATACATATGTAAAA
TCTTGATTTTTCAAAAAATATTCTGCTTTTCAAAAAGATGAACAATCTTTAATTTCACAAACTGGCAAATCTACAGCTAACAAAAAAAATAACGGTAGAC
CACCAAAAAGAAAAGAAGTTAATGAATATACAAGAGAAGAATTAGAAGAGATTGTTAAAATTTATAGAATAATTTTTGATGACATTAGTGAAAAAGAAAT
TCGAAAAAAAATTAAAGAACATAAAGATAAAGAAAAAATATTAACTAAAATTTCATGAAAAGAATTTCTCTTTTCAAAATCAACATATTATTCTTGAAAA
AAACCTAAACTTGCAGAGCCGAAAAAAGATCAAGAAATTGAAGAAATTATTAGAAAATCATTTCATGAAAACAAAGGTATATTTGGTAGAAAAAGATTAG
AAATTTATATTCAAAATAAATATAAAAGGTATATAAACTATCGAAAAATAGGTAGAATTTTGCTTAAATTAAATCTTTTTTGCAAAATTAGAAGAGCAAA
AAGAAAAAATGAAATTAAAAATCTTAATACTAAATATCAAAATCTAATTCAAAGAGACTACAATGGCAAATTTAACAACATAGTTGCCACTGATGTAACT
TATATTCCAAGCCCCAAAGATGCAATTAACAATCATGTTTATTTATCGATTGCAATTCATCATCAAAGCAAGAAAATAATTAATTGAAATCTAAGTAAAA
GAAATGATGTTAAGTTAGTTTTAGATCATATTTCTAAAATCAAATTTGATAAAGAGTGAATAATTCACTCAGATCATGGAAGTCAATATTCATCAAATCA
GTATAGTGAAATTATTAAAGAAAACAATGGGATAATTTCAATGAGTAGAATCGCAAATTCACTTGATAATCGAGAAGCAGAATATTTCTTTTCAAATATC
AAAAGTGAGTGCTTAAATGATCTAAAAATTTCAAAATTATCATTCAAAGAATTGCAAGAAATTATTCAAAATTATATTGACTGATACAATAATGAAAGAT
TACAATCAATCTTAGAATGAAAAACACCTCAACAAAGCTGAGATGTTCTAAGTGTTTTTTAAATAGTCACTTTTTTTGTCCTAGTTTA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1203 bp400 aa601262+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKQLKPEQWKKWFSLYEEFYDGKINIKKYIFLVNKNIGKDWKNTYVKSWFFKKYSAFQKDEQSLISQTGKSTANKKNNGRPPKRKEVNEYTREELEEIVK
IYRIIFDDISEKEIRKKIKEHKDKEKILTKISWKEFLFSKSTYYSWKKPKLAEPKKDQEIEEIIRKSFHENKGIFGRKRLEIYIQNKYKRYINYRKIGRI
LLKLNLFCKIRRAKRKNEIKNLNTKYQNLIQRDYNGKFNNIVATDVTYIPSPKDAINNHVYLSIAIHHQSKKIINWNLSKRNDVKLVLDHISKIKFDKEW
IIHSDHGSQYSSNQYSEIIKENNGIISMSRIANSLDNREAEYFFSNIKSECLNDLKISKLSFKELQEIIQNYIDWYNNERLQSILEWKTPQQSWDVLSVF

 

Blast result :
Comments
IS1138B differs from IS1138 by 3 nt (2 aa).
References
1] Bhugra, B., and Dybvig, K. (1993) Mol. Microbiol. 7, 577-584.