IS1136

  • Family IS200/IS605
  • Group IS1341
MGE type ISRelated element(s) :
Isoform Synonym(s) IS1136A, IS1136B, IS1136C, IS1136D
Accession numberTranspositionOriginHost
L07626 ND Saccharopolyspora erythraea
Saccharopolyspora NRRL18369
Saccharopolyspora erythraea NRRL2338
Saccharopolyspora L53-18
DNA section
IS Length : 1402 bp

Ends


Left end : CTTTTCTCCAATCGGCGGAAGCGCCGGCGTTCACGCAGGGAAGGAGCCGATCCCGAGCGCTCCTCAGTGACCACGTACCCGCGCTTACTCGTGATCGGCA II struct. : Yes
Right end : GTCCGCAAGGGTCCTCCCTTCGGCAGTCGGCGGTGAAGCAGGAACCATCGGGCGCCAGCCCGATGGCAATCCCCGCCCTTTAGGGCAGGGAAGAAGTCAA II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
TCGCTGTCAGTCACAGTTCCTCGGTCAA

DNA sequence

CTTTTCTCCAATCGGCGGAAGCGCCGGCGTTCACGCAGGGAAGGAGCCGATCCCGAGCGCTCCTCAGTGACCACGTACCCGCGCTTACTCGTGATCGGCA
ATCGGGTTGAATGATCTTTGTGAGGACGGCGTACAGGGTTCGGGCTTACCCGGCCCCCGAACAGGCGGCCCAGTTGGGCCGACCTTCGGGTGCGTCGCGC
CTGGTGTGGAACAAGACCCTCGCCGAGCGGCACCGCGCCTACCACGCGCACGGCAGAAAGACCTCCTGTAGGGAGGCCGATGCCGCGCTGACGGCATGGA
AGAAGACCGACGAGCCGGCGTTCCTGTCTGAGGTGTCGAGCGTGCCGTTGCAGCAGACACTTCGGCACCAGCACACCGCGTATGCGAACTTCTTCGCCGG
GCGTGCGCGCTACCCGCGTTTCAAGCCCCGCAACGGCCGCCAGTCGGCGCACTACACGCGCAGCGCTTTCCGCCTGCGCGGCGGCAAGCTGACTCTGGCG
AAGCACACCGCGCCGCTTGAGTTCGTGTGGTCCTGGGACGACGAAACCCTCGCAACGCTGAATCCGACGATGGTGATCGTGTCCCGCGAGCCGGATGGCC
GCTGGTATGTGACCTTGGCCGTGGACACCGACGACCCCGAACCGCAGCCCGAGACCGGCAGCGCGGTCGGGGTGGACCTGGGTGTGAAGGACTTTGCTGT
CCTGTCGACAGGCGAGAAGATCGCCAACCCGAAGCATCTGGACCGCAAGGCCCGCAACCTCGCCCGCTACCAGCGGCAAATGGCCCGCAAGCAGAAGGGC
TCGAACAACCGCCGCAAAGCCAAGACCAAGGTCGCACGGGCACACCGCGAAATCCGGTGTGCCCGCACCGACTTCCTGCACCGCACCACCACGAACCTGG
TGCGCGAGCACGACGCCATCGCGATCGAAGACCTCAACATCGCCGGAATGGCCCGCTCCGCGAAGGGCACCGTGGCCAAGCCTGGCCGTAACGTGCGCGC
CAAATCCGGATTGAACCGTGCCGTGATGGACGCGGCGTTGGGCGAGTTCCGGCGGCAACTGGAGTACAAGACCACCCGCGCGGGCAAGACGCTGGTCGTC
ATCGACCGCTGGTACCCGTCCAGCAAGACGTGCTCGGCCTGCGGGCACCTGCTGGAGAAGTTGAGCCTTTCCACCCGGGCATGGACGTGCCCGGGATGCC
GCACCCGGCACGACCGGGACATCAACGCGGCGAAGAACATCCTTGCCGCTGGTCGAGCGGTAGCCGGGAAGACCCCCGGCGATGCCTGTGGAGCTGACGT
GAGTCCGCAAGGGTCCTCCCTTCGGCAGTCGGCGGTGAAGCAGGAACCATCGGGCGCCAGCCCGATGGCAATCCCCGCCCTTTAGGGCAGGGAAGAAGTC
AA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1275 bp424 aa1111385+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MIFVRTAYRVRAYPAPEQAAQLGRTFGCVRLVWNKTLAERHRAYHAHGRKTSCREADAALTAWKKTDEPAFLSEVSSVPLQQTLRHQHTAYANFFAGRAR
YPRFKPRNGRQSAHYTRSAFRLRGGKLTLAKHTAPLEFVWSWDDETLATLNPTMVIVSREPDGRWYVTLAVDTDDPEPQPETGSAVGVDLGVKDFAVLST
GEKIANPKHLDRKARNLARYQRQMARKQKGSNNRRKAKTKVARAHREIRCARTDFLHRTTTNLVREHDAIAIEDLNIAGMARSAKGTVAKPGRNVRAKSG
LNRAVMDAALGEFRRQLEYKTTRAGKTLVVIDRWYPSSKTCSACGHLLEKLSLSTRAWTCPGCRTRHDRDINAAKNILAAGRAVAGKTPGDACGADVSPQ
GSSLRQSAVKQEPSGASPMAIPAL

 

Blast result :
Comments
The first 110-aa segment of IS1136 putative transposase is similar to the plasmid-borne vsdF (Krause et al., 1991) and orfE (downstream of spvD [salmonella plasmid virulence], Gulig et al., 1992) gene products, both associated with, but not belonging to, other plasmid-borne virulence genes in Salmonella dublin and Salmonella typhimurium, respectively. The 200-aa C-terminal segment of ORF424 matches aa [141-402] from IS891 ORF from Anabaena (35 % identity) and an URF from Synechococcus (Zhou et al., 1992). IS1136A is associated with eryAI and eryAII genes, responsible for the formation of the macrolactone portion of erythromycin.

IS1136B is 95 % identical (over 893 nt) to IS1136A. The two Accession numbers correspond to right and left ends, complete sequence is unknow. Accession numbers : L07627 and L07628.

IS1136C partial sequence (179 and 376 bp) is less than 90 % identical to that of IS1136A.The two Accession numbers correspond to right and left ends, complete sequence is unknow. Accession numbers : L07629 and L07630.

IS1136D is 79 % identical (over 202 nt) to IS1136A.The two Accession numbers correspond to right and left ends, complete sequence is unknow. Accession numbers : L07631 and L07632.

This file IS1136 replace the IS1136A, IS1136B, IS1136C and IS1136D files. They are all variants of the same sequence.
References
1] Krause, M., Roudier, C., Fierer, J., Harwood, J., and Guiney, D. (1991) Mol. Microbiol. 5, 307-316.
2] Zhou, J., Gasparich, G.E., Stirewalt, V.L., de Lorimier, R., and Bryant, D.A. (1992) J. Biol. Chem. 267, 16138-16145.
3] Gulig, P.A., Caldwell, A.L., and Chiodo, V.A. (1992) Mol. Microbiol. 6, 1395-1411.
4] Donadio, S., Staver, M.J., McAlpine, J.B., Swanson, S.J., and Katz, L. (1992) Gene 115, 97-103.
5] Donadio, S., and Staver, M.J. (1993) Gene 126, 147-151.