IS112

  • Family IS5
  • Group ISL2
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
X56644 Y Streptomyces albus
Streptomyces albus G J1147
DNA section
IS Length : 883 bp

Ends


IR Length : 16/20

IRL : AGGGCTGTCCCGTAACTGCTGGTCACAGATGAGATGATCTTGGCGTGGCT
IRR : AGGGTTGTCCCGCAAATGATCTTCGGGTCGCCTCGGGTATGGGGGAGGCC

Insertion site


Left flankDirect repeatRight flankDR Length
CTCCCATTGCTAGGGACCGTCT2

DNA sequence

AGGGCTGTCCCGTAACTGCTGGTCACAGATGAGATGATCTTGGCGTGGCTGGTGTGATCACTGCGTCGGAGCCGTCCTGGATTGCCCCGTTCAGCGGGCT
GAGCCCGAGGCAGTTCGGGAAGCTGGTGACGGTGCTGCGTCGCGAGGGTGCGGACGCGGTCCGCAAGGGCCGGCCGTGGAGCCTGCCCCTGGAGGACCGG
GCACTGCTGGTCGCGGCGTACTGGCGCACAAACCTGACCATGCGGCAGCTCGCCCCGCTGTTCGGGGTGTCGAAGTCGGCGGCGGACCGGATCATCGACC
ACCTCGGACCGATGCTCGCGCTCCAGCCCCGCAAGCGATTCGCCAAGGACACCGTGCTCATCGTGGACGGCACACTGGTCCCCACCCGGGATCACACCAT
CGCCGAGCGGTCGAAGAACTACCGGTACTCCACCAACCACCAGGTCGTCATCGATGCCGACACCCGCCTGGTCGTGGTGGTCGGACGGCCGCTCGCCGGC
AACCGCAACGACTGCAAGGCATGGGAGGAATCCGGCGCAAAGGCCGCCGTCGGCAAGACCCTCACGATCGCCGACGGCGGCTACCCGGGCACCGGACTCG
TCATCCCGCACCGCCGAGAGCGCGGACAGGCCGGACTCCCGGACTGGAAAGAGGAACACAACAAGTCCCACAAGCAGGTCCGAGCCCGCGTCGAGCACGT
CTTCGCCCGCATGAAGACCTGGAAGATCCTCCGCGACTGCCGCCTGAAGGGCGACGGCGTCCATCACGCCATGCTTGGCATCGCCCGCATGCACAACCTC
GCCCTCACCGGATAAACCGGCGGTCCGCACAACGGCCTCCCCCATACCCGAGGCGACCCGAAGATCATTTGCGGGACAACCCT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
771 bp256 aa45815+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

VAGVITASEPSWIAPFSGLSPRQFGKLVTVLRREGADAVRKGRPWSLPLEDRALLVAAYWRTNLTMRQLAPLFGVSKSAADRIIDHLGPMLALQPRKRFA
KDTVLIVDGTLVPTRDHTIAERSKNYRYSTNHQVVIDADTRLVVVVGRPLAGNRNDCKAWEESGAKAAVGKTLTIADGGYPGTGLVIPHRRERGQAGLPD
WKEEHNKSHKQVRARVEHVFARMKTWKILRDCRLKGDGVHHAMLGIARMHNLALTG

 

Blast result :
Comments
IS112 is responsible for the inactivation of the SalI restriction-modification system of Streptomyces albus G. IS112 is similar to IS493 (29 % identity for the transposases).
References
1] Rodicio, M.R., Alvarez, M.A., and Chater, K.F. (1991) Mol. Gen. Genet. 225, 142- 147.