ISGaba2

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
MGXR01000003 ND Gammaproteobacteria bacterium
Gammaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_42_43
DNA section
IS Length : 1117 bp

Ends


IR Length : 25

IRL : CCTGCCTATCCGGTTGTCACCCAATTTGATTTAAGGTACAGTGCGCCGTA
IRR : CCTGCCTATCCGGTTGTCACCCAATGTCAAATTCATGACCAATTTTAGCG

Insertion site


Left flankDirect repeatRight flankDR Length
CAGTGGTTGTTTAAATTAAGCTATTTTCACGCGACGTTTA0

DNA sequence

CCTGCCTATCCGGTTGTCACCCAATTTGATTTAAGGTACAGTGCGCCGTAGAAGAATGCGGCAATGACAGATACAATTGGCAATCAGAAAAATGATGTTA
ATAAGCCAATTGACTGCCCAATGAATATTCTAGAATTTCAAAAAATGTTTCCGGATGAGACCGCTTGCATAAAATATTTAGAACGCATGCGATGGCCAGA
TGGTTTCTGTTGCAGTAAATGTTCTCAAGTTGGTGAGCCATTTAAATTCTCAAAACGTCCTCATGTTTTGAGATGTAAAGCGTGTCATGACGATACATCG
ATCACTGCCAACACTGTAATGCATCGCAGTAAAACTGACATTCTCGTATGGTTTTGGGCTGCACATCTTGTTGCAACACAAACGCCCGGTGTATCTGCGC
TTGAGCTTCAGAAAAAATTAGGCATTGATCGATATGAAACAGCATTTCAAATGTTGCACAAACTCAGAAGCGCAATGGTCCGTCCAAATAGAGACAAAAT
TGGCGAAGAATGGCCATTAGAATTAGATATTGTATACGTTGGAGGCAAGACAAAAAGCGGTATTTCAGGCAAAACAAGCCAAACACCCGTTATTATCGCA
GTTGAGCTCAAACAACGAGAGATCCGCGACCCGATTACAAAGAAAATAAAGCAGCGCGCCCAAGCTGGCCGCATAAGATTGCAAACGCTGCCAAATAAAA
TGGCTGTAAACGTTAATCAATTTGCACAAAATTGCATCTCATCTGGCGCATCCATTGTTAGTGATGATGGCGCAGAATTTTCAGGTCTCAGTAAGCTTGG
GTTTAAACATGAAGCAGTGGCAATGCGTGGCGATAAAATAAAAATGGATAGCACGTTACCCATGATCAGTGTTGTCACAGCTAATTTGAAAACTTGGATT
GACGGAACATTTCATGGCGTTATAAAAAAACACCTGCAAGCGTATTTGAATGAGTTTATGTTTAGATTTAATCGTCGATTTTATCGCGCAATCTCATTTC
GCTCATTACTTGAGCTCGGCGCGCTCACCCCAGGTGTGACTTATAAAGACGTGTATGGAAAATCAGACGCTAAAATTGGTCATGAATTTGACATTGGGTG
ACAACCGGATAGGCAGG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1038 bp345 aa641101+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MTDTIGNQKNDVNKPIDCPMNILEFQKMFPDETACIKYLERMRWPDGFCCSKCSQVGEPFKFSKRPHVLRCKACHDDTSITANTVMHRSKTDILVWFWAA
HLVATQTPGVSALELQKKLGIDRYETAFQMLHKLRSAMVRPNRDKIGEEWPLELDIVYVGGKTKSGISGKTSQTPVIIAVELKQREIRDPITKKIKQRAQ
AGRIRLQTLPNKMAVNVNQFAQNCISSGASIVSDDGAEFSGLSKLGFKHEAVAMRGDKIKMDSTLPMISVVTANLKTWIDGTFHGVIKKHLQAYLNEFMF
RFNRRFYRAISFRSLLELGALTPGVTYKDVYGKSDAKIGHEFDIG

 

Blast result :
Comments
ISGaba2 is 85% aa similar to ISAlba3.
References
1] ISfinder annotation (2017)
2] Anantharaman,K., Brown,C.T., Hug,L.A., Sharon,I., Castelle,C.J., Probst,A.J., Thomas,B.C., Singh,A., Wilkins,M.J., Karaoz,U., Brodie,E.L., Williams,K.H., Hubbard,S.S. and Banfield,J.F. (2016) Nat Commun 7, 13219.