ISGau3

  • Family IS3
  • Group IS51
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AP009153 ND Gemmatimonas aurantiaca
Gemmatimonas aurantiaca T-27 DNA
DNA section
IS Length : 1253 bp

Ends


IR Length : 27/35

IRL : TGAAATGCCCCGGGTTCCGTGGACACCTACTTAAGGTGTTTACATTGGAA
IRR : TGAAATGCCCCAGCTTTCGTAGACAGTGAGTTAAGCTACTGCATGTAGCC

Insertion site


Left flankDirect repeatRight flankDR Length
GAACTCGACGCGCTGCCGTCTTG3

DNA sequence

TGAAATGCCCCGGGTTCCGTGGACACCTACTTAAGGTGTTTACATTGGAAACGGAGGTGGCGCATGAAGCGGACACGACGGCGGTTTACCGCCGAGTTTA
AGCACGAGGCGGTGCGGTTAGTGCGGGAGCGCGGCGTGTCGATCGCGCAGGCGGCGCGCGAGTTGGAGATTCACGAGAATTTGTTACGCACATGGTTGCG
CGCGGTAGACGAGGATGCCGAGCATCCGTTCCCTGGCGTCGGGCAGCAAAGGCCCGAACAGGCGGAGATCGCACGGTTACGACGCGAAGTGGCGCGCTTG
AAGGCGGAGCGCGACATCCTAAAAAAAGCCACCGCGTTCTTCGCGAGGGAATCGACGTGAAGTTCGGTTTCATTGCGAAACACCGAGGCACGTGGTCGGT
CGAGCTTCTCTGCGACGCTCTCGGCGTGTCGCGCAGCGGATTCTACGCGTGGTGCACGCGTCCGCCGTCTATCCGCGAGCAAGTGGATGACACGCTGCTC
ATGGCAATGCGGCAGAGTTTTGCGGCAAGTGATCGCACGTATGGCGTGCGCCGGGTGTGGCGCGATGTGCGCGACGCGGGCCTCACGAGTGGCCGAGAGC
GCATCGCGCGCCTGATGCGCTATGCCGGTCTGCGTGCGCAGCCGAAGCGCCGACAGCGGCCACGCGACGCGCGCACGGACGTCGTGCACACGCTCGCGCC
GAATGTCCTCGATCGGCAATTCACCGCGACGGCCCCGAATCAGAAATGGGTCGCGGATTTCACATATGTCTGGACCGGCGAAGGGTGGCTCTTTGTCGCG
GTTGTGCTCGATCTGTTTTCACGACGCGTCGTGGGGTGGTCGATGCAAGCCGCCATGACCGCGCAGCTCGTCGCGGATGCGCTCGTGATGGCCGTCTGGC
GTCGCGGACGCACGACGGCGCTCGTCCACCACTCCGACCGCGGCTCGCAATACACGAGCGAACACTTCCAACGCTTGCTGCGCGATATCGGCGTCACGTG
CAGCATGAGTCGCGCGGGCAATGTGTGGGACAACGCCGTCGCCGAAAGCTTCTTTGCGACCCTCAAAACCGAACGCGTGCATCGGCAGCACTATCGCACG
CGGAACGACGCACGCGCCGACATCTTCCATTTCATTGAGCGGTTTTACAATCCTGCGCGGAGGCACTCCAAACTCGGTTATCTCAGTCCGCTCGACTTCG
AGCGGCTACATGCAGTAGCTTAACTCACTGTCTACGAAAGCTGGGGCATTTCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
297 bp98 aa64360+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MKRTRRRFTAEFKHEAVRLVRERGVSIAQAARELEIHENLLRTWLRAVDEDAEHPFPGVGQQRPEQAEIARLRREVARLKAERDILKKATAFFAREST

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1041 bp346 aa1831223+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

VTHMVARGRRGCRASVPWRRAAKARTGGDRTVTTRSGALEGGARHPKKSHRVLREGIDVKFGFIAKHRGTWSVELLCDALGVSRSGFYAWCTRPPSIREQ
VDDTLLMAMRQSFAASDRTYGVRRVWRDVRDAGLTSGRERIARLMRYAGLRAQPKRRQRPRDARTDVVHTLAPNVLDRQFTATAPNQKWVADFTYVWTGE
GWLFVAVVLDLFSRRVVGWSMQAAMTAQLVADALVMAVWRRGRTTALVHHSDRGSQYTSEHFQRLLRDIGVTCSMSRAGNVWDNAVAESFFATLKTERVH
RQHYRTRNDARADIFHFIERFYNPARRHSKLGYLSPLDFERLHAVA

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1160 bp386 aa641223+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKRTRRRFTAEFKHEAVRLVRERGVSIAQAARELEIHENLLRTWLRAVDEDAEHPFPGVGQQRPEQAEIARLRREVARLKAERDILKKSHRVLREGIDVK
FGFIAKHRGTWSVELLCDALGVSRSGFYAWCTRPPSIREQVDDTLLMAMRQSFAASDRTYGVRRVWRDVRDAGLTSGRERIARLMRYAGLRAQPKRRQRP
RDARTDVVHTLAPNVLDRQFTATAPNQKWVADFTYVWTGEGWLFVAVVLDLFSRRVVGWSMQAAMTAQLVADALVMAVWRRGRTTALVHHSDRGSQYTSE
HFQRLLRDIGVTCSMSRAGNVWDNAVAESFFATLKTERVHRQHYRTRNDARADIFHFIERFYNPARRHSKLGYLSPLDFERLHAVA

 

Blast result :
Comments
ISGau3 is 79% aa similar to ISHar2.
The third ORF is a putative ORFAB transposase reconstructed in silico by a possible -1 frameshift.
References
1] Ichikawa, N. (2010) Direct submission
2] Oguchi,A., Ankai,A., Yashiro,I., Takahashi,M., Terui,Y., Fukui,S., Yokoyama,H., Ichikawa,N., Takasaki,K., Miura,H., Matsushita,S., Watanabe,Y., Sekiguchi,Y., Nakamura,K., Tanikawa,S., Hanada,S., Kamagata,Y., Fujita,N. and Kikuchi,H. (2006) Direct submission Genbank