ISGbr1

  • Family IS1380
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_ABTV01000017 ND Gordonia bronchialis
Gordonia bronchialis DSM 43247
DNA section
IS Length : 1645 bp

Ends


IR Length : 23/27

IRL : CCTCGATCCACCGATTTGCTTGTGATCGGTCGGTGAGGGATAAACGAAAT
IRR : CCTCGATCCACCGATCGGCTTTTTGATGTCTCGTGAAATGTGTTGTGTAT

Insertion site


Left flankDirect repeatRight flankDR Length
GCACGGCTGGCTTAGTGGTCCCCAC5

DNA sequence

CCTCGATCCACCGATTTGCTTGTGATCGGTCGGTGAGGGATAAACGAAATGCCCTGTCTGAGTGACAGAATGGGACTTCTCTAGGGTTCCATCCACACAC
ACAGGAGGGCATGTCGTAGATGCGATTGTCTCACACTCACCCGGTCCGGTCTGCATCCTGTGACGATCCGAATCTCCTCGCCGCTGCGGGGGTGGTGCCG
GTGATGGCGCTGGCCGAACGCGCCAGCCTGTCGGAGTTGGCCCGCGAGCATCTGAGCGTGCCCACCGACAAGGGCGCCCATCCGGATCGGAAAATGTTTT
CCCTGGTGGCGGGGATGGTGGCGGGCGCCGACAGCATCGACGACATGGCCGTGTTGCGACACGGCGCGATGGGCAAGGTGTTCGACCATCCTTACGCCCC
GTCGACGTTGGGATCGTTTCTTCGCGAGTTCCGGTTCGGGCATGTCCGCCAAGCCGATGCGATCGCCACCCGGCTGTTGGCGGGACTGGCTCGCCATACT
CCGGTGCTGGCGGGGATCGACGGGCCGGTGATGATCGATATCGACGACTCGATCATCGAGGTCCACGGCCCGGCCAAGCAGGGCGTCGGATTCGGCTACA
CCCGAGTGCGTGGGCTGAACTCGGCGATCACCACCCTCACCTGTGGTGACGGTGCGCCGGTGATCGCCGCTCAACGCCTGCGCAAAGGGGCGTGTAACTC
CGCGCGCGGGGCGCATCGGTTGATCGCCGACACCCTGGCCACCGTGCGGCGGCTACGGTCGTCCGATGCGTCGGGACCGATACTGCTGCGAGCGGATTCA
GCGTTCTACGGCCATCGCGCGATCACCACCGCGCTCCGGGCCGGTGCGCAGGTGTCGGTCACCGTGCGTCAGGATTCCCACGTCCGAGCAGCGATCAGCG
AGATACCGGCAGATGCATGGACGCCGATCGAGTACACCGACGCCGTCTTCGACGAAGACAGCGGCCAGTGGGTCTCGCGGGCCGAGGTCGCCGAAGTACC
GTTCACCGCGTTCACCTCCAAAGCCAAGCGCCTGCAGGTATCCGGACGGCTGGTGGTGCGCCGTATCCCTGACTTCGCAGCCGAGGGAGACGGCTTGTTC
GACGTGTGGCGGTTTCATGCGTTCTTCACCACCAGCGACCTGGACACCGTGACCGCCGACAAGACTCACCGCGGTCATGCGATCATCGAGCAAGTCCACG
CCGACCTCAAAGCCTCCGCATTGGCGCATCTGCCCTCGGGAAAGTTCTGCGCGAACGCCGCATGGCTGGTGTGTGCGGTCATCGCGTTCAACCTGACCCG
CGCCGCAGCCTGTCTCGGTGGACAGCGTCTGGCGAAGGCGACTACCTCCACCATCCGACGCACCCTGATCTGCATACCCGCTCGAATCGCGTCCTCAGCG
CGGCGCATCACGATGCATCTACCCGCCCGATGGCCGTGGGAACGCGAGTGGAACCTGTTGTTCAACAACACGATCAAACGACAACACTCAGCCTGACCCC
TAACCATCGGCCAGAACCGGCCCCGACACGAAACCCAGTGAAACACGCCGACACCAGAGATCGGCGACTCACCCACGCCCACCGCCACCCCGAACATACA
CAACACATTTCACGAGACATCAAAAAGCCGATCGGTGGATCGAGG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1305 bp434 aa1921496+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MVPVMALAERASLSELAREHLSVPTDKGAHPDRKMFSLVAGMVAGADSIDDMAVLRHGAMGKVFDHPYAPSTLGSFLREFRFGHVRQADAIATRLLAGLA
RHTPVLAGIDGPVMIDIDDSIIEVHGPAKQGVGFGYTRVRGLNSAITTLTCGDGAPVIAAQRLRKGACNSARGAHRLIADTLATVRRLRSSDASGPILLR
ADSAFYGHRAITTALRAGAQVSVTVRQDSHVRAAISEIPADAWTPIEYTDAVFDEDSGQWVSRAEVAEVPFTAFTSKAKRLQVSGRLVVRRIPDFAAEGD
GLFDVWRFHAFFTTSDLDTVTADKTHRGHAIIEQVHADLKASALAHLPSGKFCANAAWLVCAVIAFNLTRAAACLGGQRLAKATTSTIRRTLICIPARIA
SSARRITMHLPARWPWEREWNLLFNNTIKRQHSA

 

Blast result :
Comments
ISGbr1 is 76% aa similar to ISRjo1.
References
1] ISfinder annotation (2009)
2] Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T., Wu,D., Klenk,H.-P. and Eisen,J.A. (2009) Direct submission GenBank.